KEGG   Malassezia globosa: MGL_0247Help
Entry
MGL_0247          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mgl  Malassezia globosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MVEPAPNFRPSRSKVAYYYDNDVGNFSYGFGHPMKPHRMRMAHNLILNYGLDKHMEILRP
PRATRQQMTKFHTDEYIDFLSRVTPESAPKLTGDGTRYLIGEDCPAFDGLFEFCTISCGG
SIAGANRINDGLADIVVNWSGGLHHAKKREASGFCYTNDIVLAILELLRTHSRVLYIDID
VHHGDGVEEAFYVTDRVMTCSFHKFGDFFPGTGDVRDIGMKKGKAYAVNVPLRDGIDADT
FGSIFRPVIQHIMDWFRPGAVVLQCGADSLAGDKLGCFNLSMRGHANCVEFVKSFGVPMM
CVGGGGYTVRNVARTWTFETGLLLGKELPVDLPFNDYIQYFGPEYKLDVPSTGMDNLNTP
QYLDGLRTRIIDNLRSMPFAPSVQMQETPRTSLLSAAGADPDLSEDEDSDLDERISQRLR
DRHTQAFGDVLSDDEDEPNSMTAYEADMAMMQAAARPPAGPWAPPMPMPLGGAAGPSLMT
YPRE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggttgagccggcgccaaacttccgaccgtcgcgctcgaaagtcgcatattactatgac
aatgatgtagggaacttctcgtacgggtttggacatccgatgaaaccgcatcgaatgcgc
atggcgcacaacctaatcctaaattacggcctcgataagcacatggaaattcttcgaccg
cctcgtgctacgcggcaacagatgaccaagtttcacactgacgagtatattgacttcctc
agtcgcgtcacgcctgaatcagcaccgaagctaacaggagatgggacacgctacctgatt
ggcgaggattgtcctgcctttgatgggttgtttgaattctgcacaatatcctgcggtggc
tctattgccggtgcaaaccgaatcaacgacggcctcgctgacattgtggtcaattggtca
ggtgggctccatcatgctaagaaacgtgaggccagtggattttgctacacaaatgatatt
gtgctcgcaattcttgagctcttgcgcacgcattcacgtgttttgtatatcgacatcgat
gtgcaccatggtgatggggttgaggaagccttctacgtgacagatcgtgtcatgacctgc
tcatttcacaagttcggcgactttttcccagggacaggcgatgtgcgagatatcggaatg
aaaaaaggcaaggcatacgcagtaaatgttccgttacgagacggaattgacgctgacact
tttggctcgatctttcgtcctgtgattcagcacatcatggactggtttcgcccgggtgca
gttgtcttgcaatgcggcgctgactcacttgcaggcgacaagctaggctgcttcaacctc
agtatgcgcggacatgcaaactgtgttgagtttgtcaagtcgtttggcgtacccatgatg
tgtgtgggcggtggtggatacaccgtacggaatgtcgctcggacatggacgttcgagaca
ggtcttttgctgggcaaggaactacctgtggatctgccatttaatgactacattcagtac
ttcggccctgagtacaaactggatgtgccatcaacaggtatggacaacttgaatacaccg
cagtatcttgatggacttcggacccgtattattgacaacctacgatctatgccatttgca
cctagcgttcagatgcaagaaacgccgcgcacatcgctattatcagcagcaggtgcagat
ccggatctgtccgaggatgaagactcggacttggacgagcgcatctctcagagattacgc
gaccgtcacactcaggcgtttggcgacgtgcttagtgacgatgaagacgaaccaaacagc
atgacagcctacgaagctgacatggcaatgatgcaagcggcggcgcgacctccggctggt
ccttgggcgccgcccatgcccatgcccctcggcggagctgctggcccgtcgctcatgaca
tatcctcgtgaatag

DBGET integrated database retrieval system