KEGG   Malassezia globosa: MGL_0270Help
Entry
MGL_0270          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
mgl  Malassezia globosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 627 aa AA seqDB search
MHQIYSREATRAEIELIHDSALWDQYEANMTLPLAQLKTLSHDLELSSSLYLNHASTFCA
RLSCGSVVEMCSAVASGRVHNGFAIVRPPGHHAEPGAGFGFCLYNNVAVSTRVLLDRPLG
APDRVERVMILDWDVHHGNGTQRAFWDNKQVLYISLHRYENGTFYPGTSFGNYDQVGGES
ARGTSVNVPWPCSGMDDGDYLHAFQHCIMPIAYEFAPDLVIVSAGFDAAQDDMLGGCLVS
PAGYAHMTHQLMALAQGNLVVALEGGYTLDAISRSALAVVRTLLGDPLPPLPRGTACSLA
AADTVRRVIRAQAPYWVSLRTALEYGPSAVPNSLTASTLNAATTDAVHGAALTHVTDSTT
DAAAAQISTTPSAASVACIPTPELLLDARAARLWKRHQLLPIPTHAGLQRNQALCSSSLM
LPTTQTLVIFVHDLANLHKDVQGAPYVADSADALVQWAMERNYALMDLCTMVPLPLQTVR
NHSHGKALAYPDDPTPSALNEQIQHIWDVYCAISPVPKVFLVGLGTGCEVLMHLITTRAI
QSRVHGMVQVMGMNSIPLVPKAQRELKSWYLKHARVICPPTHPYFAWNEQASSGKRLGTV
QRAHSPCPMETLVQCLPNIDSMLSTSS
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagatctactcacgagaagctactcgtgcagaaattgagctgatccacgactct
gccctgtgggaccagtatgaggcaaacatgacacttccgcttgcgcagctcaaaacattg
agccatgatctagagttgagctcatcgctgtatctgaaccatgcatctacgttctgtgca
cggctctcgtgcggaagtgtcgtcgagatgtgctcggctgtggcatcaggcagggtacat
aatggtttcgccattgtgagaccgccaggacatcatgctgagcctggagctggatttgga
ttctgcttgtataataatgtggcggtgtctacacgtgtcttgctcgatcgaccactgggt
gcgccagaccgggttgagcgcgtgatgattctggactgggacgtgcatcatggaaatggt
acacagcgtgcattctgggacaacaagcaagtgctgtacatatctctgcatcgatatgaa
aatggtacgttctaccctgggacctcgttcggcaactacgaccaagtcggcggtgagtcg
gcgcgtgggacctcggtgaatgtgccctggccatgcagtggcatggacgatggtgactac
ctgcacgccttccagcactgcatcatgccgatcgcatacgagtttgcgccagatctcgtc
attgtaagtgcgggcttcgatgccgctcaggatgacatgcttggcggctgtctcgtgtcg
cccgctggctatgcacacatgacgcaccagctcatggcacttgcacagggcaacctggtt
gtcgctctcgagggcggttataccctggacgctatatcgcgctccgcactcgctgtcgtc
cgaacattgctcggcgatcccctcccaccgctccctcggggtactgcatgtagtcttgct
gcagctgatactgtccggcgagtgatccgtgcacaggccccctactgggtctctctgcgc
actgcgctcgaatatggcccgagcgcagtgccgaactctcttactgcatccactttgaat
gcagcaacaaccgatgccgtgcacggtgcggcacttactcatgttactgactcgaccact
gatgccgccgctgctcagatctccaccactccttctgcagcttctgtggcctgcataccg
acgccggagctcttgttagatgcacgtgctgctcggctttggaaacgacaccagctgctg
ccgatacctacgcatgcggggctccagcggaatcaggcactgtgttcctcatcgcttatg
ctgccgacaacgcagacactcgtgatatttgttcatgaccttgcaaatctacataaagac
gttcaaggcgcaccatatgtggccgactcagcggatgcactcgtccaatgggctatggaa
cgcaactatgccttgatggatctctgcacaatggtgcctttgcctctgcaaacagttcgc
aatcattcgcacggaaaagccctggcgtatcctgatgatcccactcccagtgcgttgaat
gaacagatccaacatatttgggatgtatattgcgcgatttcaccagtgccaaaggtgttt
ctcgtcggcctgggtaccggctgtgaagtcttgatgcatctcattacgacgcgtgccatc
cagtctcgtgtgcacggcatggttcaggtgatgggaatgaactctattccacttgttccc
aaggcccaacgtgaactcaagtcctggtacttgaagcatgctcgtgtaatctgcccacca
acacacccgtactttgcgtggaatgaacaagcttcgtcagggaagcgcctaggcaccgtc
caacgggcgcactcgccatgtcccatggagacgctagttcaatgcctgcccaacatagat
tccatgctgtcaaccagctcataa

DBGET integrated database retrieval system