KEGG   Malassezia globosa: MGL_0305Help
Entry
MGL_0305          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
mgl  Malassezia globosa
Brite
Chromosome [BR:mgl03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    MGL_0305
Exosome [BR:mgl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGL_0305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W RP-C Bt_P21 YscO-like
Motif
Other DBs
NCBI-GeneID: 5856836
NCBI-ProteinID: XP_001732530
UniProt: A8PSR8
AA seq 141 aa AA seqDB search
MPPKPAEKKPPSTAGKAPASAGKAPTEGAKKTSKAPTKSSEKKKSSSKVRKETYSTYIYR
VLKQVHPDTGISNKAMAILNSFVQDIFERIASEASKLASYNKKSTISSREIQTAVRLILP
GELSKHAIAEATRSVTKFSST
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaagcctgctgagaagaagccaccatcaacggccggcaaggcacctgcctca
gctggtaaggcaccgacggaaggagctaagaagacgtcaaaggcccctacaaagtcgtcc
gagaagaagaaatctagcagcaaggttcgaaaggagacttactcgacctacatctaccgt
gtgttgaagcaggtccaccctgacacgggtatctcaaacaaggccatggccattcttaac
tcgtttgtgcaagatatctttgagcgtattgcctcagaggcgtcgaagctcgctagttac
aacaagaagagcacaatttcttcgcgtgagatccagacagctgtgcgcctgattcttccc
ggcgaactatcgaaacacgccattgctgaggccacgcgctctgtcaccaagttctcgtcg
acataa

DBGET integrated database retrieval system