KEGG   Malassezia globosa: MGL_0305Help
Entry
MGL_0305          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
mgl  Malassezia globosa
Brite
Exosome [BR:mgl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGL_0305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 141 aa AA seqDB search
MPPKPAEKKPPSTAGKAPASAGKAPTEGAKKTSKAPTKSSEKKKSSSKVRKETYSTYIYR
VLKQVHPDTGISNKAMAILNSFVQDIFERIASEASKLASYNKKSTISSREIQTAVRLILP
GELSKHAIAEATRSVTKFSST
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaagcctgctgagaagaagccaccatcaacggccggcaaggcacctgcctca
gctggtaaggcaccgacggaaggagctaagaagacgtcaaaggcccctacaaagtcgtcc
gagaagaagaaatctagcagcaaggttcgaaaggagacttactcgacctacatctaccgt
gtgttgaagcaggtccaccctgacacgggtatctcaaacaaggccatggccattcttaac
tcgtttgtgcaagatatctttgagcgtattgcctcagaggcgtcgaagctcgctagttac
aacaagaagagcacaatttcttcgcgtgagatccagacagctgtgcgcctgattcttccc
ggcgaactatcgaaacacgccattgctgaggccacgcgctctgtcaccaagttctcgtcg
acataa

DBGET integrated database retrieval system