KEGG   Malassezia globosa: MGL_0319Help
Entry
MGL_0319          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mgl  Malassezia globosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mgl00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 435 aa AA seqDB search
MPHRSKPVSVLLLRQPVSVLQGTDPYHDTFGPFCLPSFELSALDTRSSTPGSPRSEPQQQ
SAWGDICYRTASGNEKGLDNSAKEELNSARTGPESTSKHDYLMTHHMYSTESNQREFCIT
SFPILTHQTVHINELEGIIHRVHERSTSFDGIVLPSQRAAQAYHDTCIRVYQQMASQGNH
NNLSNTSSAWSSMPFYVVGPATAKYVREMAVPAAFKPSHVRGEQAGNAESLARDVILKDI
HTLGKPCEFLYLVGDKRSSSLLDTLRAHHAPAALHELLVYETSKHPRFEANCALLERDLP
EHMSTASSSRPSSFSSQLRREGLVMTGYEPVAAEHELETDLWLRPPIQSMESFQPPQPAQ
PNWIVFFSPSGGNYALPELTQRRWIVPFERETGSKVACIGATTAQWVRQNLGFEPHAIAA
RPTPDALRSCITATI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccacatcgatcaaagccggttagcgttttgctcctgagacagccagtgtccgtcctg
cagggcacagatccttatcatgatacgtttggccctttttgtctaccatcgtttgaacta
tccgccctggacacacgcagctcgacgccaggttcaccgcgatccgaaccacaacagcaa
tctgcttggggagacatttgctatcgcactgccagtggtaatgaaaaggggcttgataat
tctgccaaagaagagttgaattctgcacgtacagggcccgagtctacaagcaaacacgac
taccttatgacgcatcacatgtacagcacagagtcgaaccagcgtgaattttgtattaca
agcttcccgatcctcacacatcaaaccgtgcatatcaacgaactagaaggcatcatacat
cgtgtgcatgagcgctccacatcatttgatggcatcgttcttccgagccaaagagccgca
caggcctatcatgacacgtgtatacgtgtgtatcaacaaatggcatctcaaggaaatcat
aataatcttagcaatacttctagtgcatggagcagcatgccattctacgtcgtaggacct
gcgacggccaagtatgtgcgtgagatggccgtgcctgctgcattcaagcccagtcatgtg
cgcggcgaacaagcagggaatgccgaatctcttgcccgtgatgttattcttaaagacatt
catacacttggaaagccatgtgaatttttgtatctagtcggtgacaagcgatccagcagc
ttgctcgacaccctacgggcccaccatgctcctgccgcgttacatgagctgctcgtttat
gaaacaagcaaacatcctcgcttcgaagcaaattgcgctctccttgaacgcgacttgcca
gagcacatgtcaactgcatcttctagccgtccctcgagtttctcatcgcaactccgtcgt
gagggactcgtcatgactggatacgagcccgttgcagccgaacatgaactagagacagac
ctttggttacggccacccattcaatcaatggagtcattccagccacctcagccagcacag
ccaaattggattgtatttttttcgccgagtggtggaaactatgccctgcctgagttgaca
cagcgccggtggattgtgccgtttgagagagaaacgggctccaaagtggcatgcattggt
gcaacaacggcccaatgggtgcgccagaacctcgggttcgaaccgcatgctatagctgca
cggccgacccccgacgcattacgaagttgcatcacggcgaccatctaa

DBGET integrated database retrieval system