KEGG   Malassezia globosa: MGL_0355Help
Entry
MGL_0355          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mgl  Malassezia globosa
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGL_0355
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MGL_0355
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGL_0355
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MGL_0355
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     MGL_0355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 558 aa AA seqDB search
MARHLSSSPKSPPPTPEQQQKQKHLSTRHRSSTPIHPGAESHHLQEIDSPVQLRSEGTMR
IVQLNRERALNALDHHMISLIDHAFNEIEPSPNAATVLFRGLARSMCAGGDVMSIVKAAD
NSDFHKRMHSSRFFEREIVQNYRVHTMREHSTELGHPKTYLGLWDGIIMGGGVGMTVHGP
IRIATERTLFAMPETAIGYFPDVGLTHTFSRMDGGIGMYVGLTGGRLNGADAYLTGFATH
YMHSHAVDEMLRRISSLPMSTATHEENVVRALDEFTVNPFDDDENLAKNCVFLGDKRVAL
DFAFTRDTIEQVIAVLDDIAQRRQDSYTGEELAKRGLPAITEDVAAWASQTHATLLARSP
RSLKVTFRAIREARDQTLAENMHANIRIATAFCDLSLGRDFHTGVMHVLGKDPKTGKRNA
GIPKWEPSRLQDVSDEYLQTFFFSTEEKARKAGMQLKVPKLHLVPVTGKDRESRKAREQE
MRGVGPLRWNSKWNKYALPSEAELAALHEGSHPASGSYVLEPAELLETIARYHNNKPGLR
LKVQDWLDRRARLQQASP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtcatctgtcatcatcaccaaaatcgccgccgccgacgccggagcagcagcag
aagcagaagcatttatcaacgcggcatagatcgtcaactccgatccacccaggtgcagaa
agccatcacctgcaagaaatcgactcgcccgtccaactcaggagcgagggaactatgcgt
atagtgcaactgaatcgcgaacgagctctgaacgcgctggatcaccacatgatttctttg
atcgaccatgcgtttaatgaaattgagccgtctcccaatgccgcaactgtcctgttccgc
gggttagcacgctctatgtgtgcaggcggtgatgttatgtcgatcgtcaaggccgcggat
aatagcgactttcataaacgcatgcacagctcgaggttcttcgagcgcgagatcgtacag
aactaccgtgtgcacacgatgcgcgagcattcgacagagctgggtcatcccaagacatat
ttgggtttgtgggatggtatcattatgggcggcggtgttgggatgactgtgcatggcccg
atccggatcgctacggaacgcaccctctttgcgatgcccgagacagccatcggttacttt
cctgatgttggtttgacccacacgttctcgcgcatggatggcgggattggcatgtacgtc
ggcctcacaggcgggcgcctaaatggcgcagatgcatacctgacggggtttgccacccac
tatatgcattcgcacgccgtggatgagatgctccgtcgcattagctcactcccaatgtcc
acggctacgcacgaggaaaacgttgtgcgtgcgctggatgagtttaccgtcaatcctttc
gatgacgacgagaaccttgcaaagaactgcgtgttcctgggcgacaagcgcgtggcgctt
gactttgctttcacgcgcgatacgatcgaacaggtgattgccgtgcttgatgacattgcg
caacgccgtcaggattcgtacacgggcgaggagctcgcgaagcgcggcctgcctgccatc
acagaagatgttgcggcatgggcgtcgcaaacgcatgcgacgctgctagcgcgttcccca
cgctcgctgaaagtgacattccgcgcgattcgcgaagcacgcgatcagacattggccgaa
aacatgcatgcgaacattcgcatcgccacggctttctgtgacctgtcgcttggccgcgat
tttcacactggtgtgatgcatgtgcttggcaaggaccccaagactggcaaacgtaatgca
ggcatcccgaagtgggagccatcgcgcttgcaggatgtgagtgacgagtacctgcagacc
ttcttttttagcaccgaagaaaaggcccgcaaagctgggatgcagctgaaagtgccgaaa
ctccacttggtgcctgtaaccggcaaagaccgcgagtctcgtaaagcgcgcgagcaagaa
atgcgtggcgttggtccattgcgctggaattcgaagtggaataagtacgcactcccaagc
gaggctgagctcgccgcgctacatgaagggagccacccagcctcaggcagttacgtgctg
gagccggctgaactgctcgagactattgcccgttaccataataacaagcctgggctgcga
ctcaaggtgcaagactggctagaccgtcgcgctcgcttacaacaagcttcgccgtag

DBGET integrated database retrieval system