KEGG   Malassezia globosa: MGL_0469Help
Entry
MGL_0469          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
mgl  Malassezia globosa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MGL_0469
Exosome [BR:mgl04147]
 Exosomal proteins
  Proteins found in most exosomes
   MGL_0469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1675 aa AA seqDB search
MAADKPINFAEHVQLQELGIAPESISFANVTLESEKYVCVRESKESGNSVAIVDLNHIQN
VVRRPMSADSAIMNPDENILALKLQRQLQVFNLASKTKIKSHTSPQDVIFWRWVSPTTLG
MVTSSSVYHWSIDNESPPQKVFDRHASLADTQIINYRVSDDGKWMVLIGISSNTVDANAF
RIKGSMQLFSLERGVSQPIEGHAATFAELKTQDSVVPYKLFSFAVRTATGAKLHIVEIDH
APENPVFTKKAVDVFFPAEATNDFPVAMQVSRRYGIVYLMTKYGFIHLYDLETGACIYMN
RVSGETVFVAAEQKSSNGIIAVNRRGQVLSVSVDADTIIPYILRTLNNTDLAFKLASRGN
LPGADNLYMQQFHSLFSAGQYSDAIKIAANSPRGILRTPQMIEQLKQVPTQPGTLSPILQ
YFGVLLESGSLNRHESLELAKPVLAQGRKHLLEKWLKEDKIECSEELGDIVRQQDMNLAL
SVYLRANVPNKVVACFAETGQFNKIVLYSKKVGYQPDYATLLRHVVRVNPEQGAEFASSL
VADEDGPLIDVERVADIFLSQNLVQQATSFLLDALKDDQPEHAALQTRLLEVNLLQAPQV
ADAILGNQMFSHYDRARIANLCEKAGLMQRALEHYDDLADIKRVVVHSNLFDNEWLVNYF
GRLTVEQSLESLYEMLRTNIRQNLQVVVQIATKYSDLLGAPKLIEMFEKFRSFEGLYYYL
GSVVNLSEDPEVHFKYIQAATRTGQIREVERICRESNAYNPEKVKNFLKEAKLPDQLPLI
IVCDRFDYVHDLVLYLYQNMMLNYIEVYVQRVNSTRAPQVIGGLLDVDCDEGVIKNLLES
VTGPIPVDELVDEVEKRNRLKLILPWLKTQIESGSEDQAVFNAMAKISIDSNKNPEAFLK
ENNLYDPLTIGKYCEKRDPYLAYIAYAKGFCDDELIEITNDNSMYKHQARYLVLRREPQL
WAKVLAEDNVHRRSLIDQVTAVAVPESTNPEDVSATVKAFMTADLPHELIKLLEPIVLET
SAFSDNRSLKNLLLLTAIRTDKAKVSGYIDRLTGYDVDEIARIAIDHGLYEEAFQIYSKA
QQNLDAMNVLVEHIVSIDRAQHFANKLNQPDIWSRLGKAQLDGLRVKDAIDSYVRAEDPA
NFDEVIEIAERAGREEELIRFLQMARKQTREPKIDTEYAYCLAKAHRLSDMEEFLSMTNV
ADVLSVGEKCFHDGLYEAARLLFSSVSNYARLATTLVYLNDFPSAIEAARKAGNTAVWKQ
MHAACLNKREFKLAQIAGLAVVPHAEDLPMLIRAYEVKGYFDELLQLLESALGLERAHMG
VFTQMGIALAKYRPSQLMEHLKLYWSRSNLPQLIKVTERAHLWRELVFLYVKYDEPDNAA
LTIMEHCSDAWDHDQFKAVLPQVANVEIYYRALTFYLEQHPLLLNDLLTVLVKRIDHARV
VRMFKKHDHDNVPLIRSYLMSVQPQNIEAVNNAYNDLLIEEEDYDTLRVSIDAYDNFDAL
ELAARLKDHELLEFRRLAAHLYRKNGRFDDSIALSKSDTLFRDAVETAAHSGEPSVAEDL
LSYFVDTGNKECYAAMLFACYDLLLPDVVMEMSWRHALQDFTMPYQIQQARDTRMKLQTL
EKEVRERAAKDSAKEKQDEDTPILGPGAFANRLLTASATGPDGMMMPPSAGGMFP
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggacaagccgattaactttgcggagcatgtccagctgcaggagctgggcatt
gcgcccgaaagtatatcgtttgccaatgtgacgctggaatcagagaagtatgtgtgtgtt
cgcgagagcaaagagtcagggaactctgtggcgatcgtggacctgaatcatatacagaat
gtggttcggcgacccatgagcgcagattcagcgatcatgaacccagacgaaaatatcctt
gcactgaagctgcagcgtcagttgcaggtgttcaatctggctagcaagacaaagatcaag
tcgcacacatctccacaggatgtgatcttctggcgctgggtgtccccgacgacgctgggc
atggtaacgtcgtcgagcgtgtatcactggagcattgacaatgaatcaccgccacaaaaa
gtgtttgaccggcatgcaagtcttgccgatacacaaatcatcaattaccgcgtatcagac
gacggcaagtggatggtgctgattggcatctccagcaatacagtcgatgcaaatgcgttc
cgaatcaaggggtctatgcagctgttcagtttggagcgtggtgtgtcgcagccgatcgaa
ggacatgctgctacctttgcggagctcaagacgcaggactctgtcgtcccgtacaagttg
ttctcgttcgctgtgcgcacggctacaggagcgaaactgcacattgttgagattgaccac
gcgccagaaaatcctgtgtttacgaagaaagccgtcgatgtgtttttccctgccgaagcg
acgaatgacttccctgtggccatgcaggttagccgtcgttacggtatcgtgtacctgatg
accaagtacggcttcattcacctgtatgaccttgagactggtgcatgtatatatatgaac
cgtgtctcgggcgaaacggtgtttgtcgctgcagaacagaagagttcaaacggtatcatt
gccgtgaaccgccggggccaggtgctttcggtgtcggttgatgcagacacgatcatccct
tacatcctccgcacgctgaacaatacagatcttgccttcaaacttgcctcacgcggtaat
ctgcctggcgcagacaacctgtacatgcagcaattccactcgctctttagcgctggacag
tacagcgacgccatcaagattgcagcaaactcgccacggggtattcttcggacgccacag
atgatcgagcagctgaaacaggtgccaacgcaacccggcacgctctcgcctattcttcag
tactttggtgtgttgctggaaagcggctcattgaaccggcacgagtcgctagaactcgcg
aagcctgtgctggcgcagggccgcaaacacctgctggagaagtggctcaaggaggacaag
atcgagtgcagtgaggagctcggtgacattgtgcgccagcaggacatgaatcttgccctg
agcgtgtacttgcgcgcgaatgtaccgaacaaggtcgttgcctgctttgcagagacgggt
cagtttaacaagattgtgctgtactcgaaaaaggtgggctaccagcccgattatgcaacg
ctcttacgtcacgttgtgcgcgtaaacccggagcagggagccgagttcgcgtccagcctt
gtggctgatgaagacggcccacttattgacgttgagcgtgtggccgacattttcctgagt
cagaatcttgtgcagcaggcgacctcgttcctcctcgatgccctgaaggacgaccaaccc
gagcatgcagccctgcagacacgcctgctcgaagtgaacctgctccaggcaccgcaggtt
gctgatgccattcttggaaaccagatgttttcgcactacgaccgcgctcgcattgctaac
ttgtgcgagaaggctgggcttatgcagcgcgctctcgaacactacgatgacctagctgac
attaaacgagtcgtcgtgcactcaaacctctttgacaatgaatggcttgtgaactacttt
ggtcgccttactgtggagcagtcacttgagtcgctgtatgagatgctgcgcaccaacatc
cggcagaatctgcaggtcgtcgtgcagatcgcgacaaagtactcggatctgctgggcgcg
ccgaagctgatcgagatgttcgagaagttccgcagctttgagggcctgtactactacctg
ggctctgttgtgaatctgagcgaggaccctgaagtgcacttcaagtacatccaggcggcg
acgcgaacaggtcagatccgcgaagtcgaacgcatttgccgcgagtccaacgcctacaac
cctgagaaagtcaagaacttcctcaaagaagccaagctgccagaccagctgccgctcatc
attgtttgtgaccgctttgactacgtgcatgatctcgttctgtacctgtatcagaacatg
atgctgaactacatcgaagtgtatgtgcagcgagtgaactcgacacgtgcgccgcaggtc
attggtggtctgctcgatgtcgattgcgacgagggcgtcatcaagaacctgctcgagtca
gtaacgggccccatcccagtggacgagctcgtcgacgaggtcgagaagcgcaatcggctg
aagctgatcctaccatggctcaagacgcagatcgagtcgggcagcgaagatcaggccgtc
ttcaatgcgatggccaagatcagcatcgacagcaacaaaaacccggaggcgttccttaag
gaaaacaatctatatgacccactcacgatcggcaagtactgcgaaaagcgtgacccgtat
ctcgcgtacattgcgtatgcgaagggcttctgtgatgatgagctgatcgagatcacgaac
gacaattcgatgtacaagcaccaagcacgctacctggtcctgcgtcgcgagccacagctg
tgggcaaaagtactggcagaagacaacgtgcatcgccgttcgctcattgaccaggtaaca
gccgttgccgtgcccgagtcgaccaaccccgaggacgtgtctgcaacggtgaaggcattc
atgacggcggacttgccgcacgaactcatcaagttgctggagccgattgtgctggagacg
tctgccttcagcgacaaccggagtcttaaaaacctgctgctgctcacggccatccgcaca
gataaggcgaaggtgtctggctacatcgatcggctaaccggctacgatgtggatgaaatc
gccagaatcgccattgaccacggcctgtatgaggaagcgttccagatatactccaaggcg
caacagaatttggatgcgatgaatgtgctggttgagcacatcgtctcgattgaccgtgca
cagcactttgccaacaagctgaaccagccagacatctggtcacgactcggaaaggcgcag
ctcgatggtttgcgtgtgaaggacgccatcgactcgtacgtgcgtgcagaggacccagcg
aactttgacgaggtgatcgagattgcggagcgcgctggccgtgaagaggagcttatccgc
ttcctgcaaatggcccgcaagcagacgcgcgagcctaagatcgacacggagtatgcgtat
tgcctcgcaaaggcgcaccgcctttccgacatggaggaattcctctcgatgacaaacgtc
gcggatgtgctgagtgtgggtgaaaaatgcttccatgacggcctctatgaagcggcacgt
ctcctgttttctagtgtgtcgaactacgcacgccttgcaacgacgctcgtatatcttaat
gacttcccgagcgctattgaggctgcacgcaaggctggcaacacggctgtatggaagcag
atgcacgctgcttgtctgaacaagcgcgagtttaaactggctcagatcgcaggtcttgcg
gtcgtaccgcacgccgaagatttgccgatgctcattcgtgcgtatgaagtgaagggctac
ttcgacgagcttctccagctgcttgagtcggcgctgggtctcgagcgtgcgcacatgggc
gtgtttacacagatgggcatcgctctagctaagtaccgaccttcacagctgatggagcac
ctcaagctgtactggtcgcgaagcaatctgccgcagctcatcaaggtgacggagagggca
cacctctggcgcgagcttgtgttcctgtatgtcaagtatgatgagccagacaatgcagcg
ctcacgatcatggagcactgctctgatgcatgggaccatgatcagttcaaggccgtcttg
ccccaagttgctaacgtcgagatctactaccgtgcattgacattctacttggagcaacac
ccgctcctcctcaatgacctgttgaccgtacttgtgaagcgaattgatcacgcgcgtgtc
gtccgcatgttcaagaagcacgaccatgacaatgtgccactgattcgctcgtacctcatg
tctgtgcagccacagaacattgaggctgtgaacaatgcgtacaacgacctgctcattgag
gaggaagactacgacacgttgcgtgtgtcgatcgacgcgtacgacaacttcgatgcgctg
gaactcgcagcgcggctcaaggatcacgagctcctggaattccggcgcctggcggcgcac
ctgtaccgaaagaacggccgcttcgacgacagcattgcactgtccaagtctgatacgctc
ttccgcgatgcggtcgaaactgccgcgcactctggcgagccaagcgttgctgaagatctc
ttgagctactttgtcgacacaggcaacaaggagtgctatgctgcgatgctcttcgcctgc
tacgatctcttgctgccggatgtggtgatggagatgtcgtggcgacatgcgctgcaggac
tttacgatgccgtaccaaatccagcaggctcgtgacacgcgcatgaaactgcagactctc
gagaaagaagtgcgtgagcgtgcagcgaaagactcagccaaggagaagcaagatgaagac
acgccgattctcggtcctggtgctttcgcgaatcgtctgcttacggcgtcggccaccggt
cctgacggtatgatgatgcccccgtctgccggcggcatgtttccgtaa

DBGET integrated database retrieval system