KEGG   Malassezia globosa: MGL_0551Help
Entry
MGL_0551          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mgl  Malassezia globosa
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mgl00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 640 aa AA seqDB search
MCGILGCIHHPDAQAYRSKMLTMSRAIRHRGPDWSGCVVVGADDPHKPTRGSVLCHERLA
IVGVDSGSQPLVSDDGKLYLAVNGEIYNYRQLRASLNSSVEFKTDSDCEVIMYLYREHGV
DFVNMLDGMFAFILLDTSVSPHRVIAARDPIGVTTLYYGRSFEYPGALYFSSELKAISKE
CERLFSFPPGHFYDSQRAKGDELVRYYRPSWWDTDESGQLPTATADLALIRTTLEKAVRK
RLMSEVAYGVLLSGGLDSSLIAAIAARETEKQAKVQQMELEHAHHEAAVASKTEPRSSKV
RRTEHASDATKTSDDGPLVAWPRLHSFSIGLPGSPDLLAARQAAEFLGTIHHEYTFTVQE
GLDALSDVVYHLETYDVTTVRASTPMYLLSRKIKATGVKMVLSGEGSDEVFGGYLYFHAA
PSKEAFHQESVKRVKNLHTADCLRANKSTMAWGLEARVPFLDKAFLDVCMNLDPAQKQFS
KGSLQKKDADGRPYMEKYILRKAFDVKPDDLEHGSPLEGSLPYLPESILWRQKEQFSDGV
GYSWIDGMKEYAEKTVSDDKFSERESRYPVDTPDTKEAYMIRELFESWFPTEAAARTAVR
WVPRGDWGCSSDPSGRSVAIHDAAYQQQEVAAAEVGQGGA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattctgggctgcattcatcatccagatgcgcaggcgtaccggtcaaagatg
cttactatgtcgcgagcgatccggcatcgtggtcccgattggtcgggatgtgtggtggta
ggcgcagatgacccacacaaaccaacacgtggtagcgtgctgtgtcatgagcgtttggcc
atcgttggtgtcgactctggctcgcagcccctcgttagtgacgatggaaagctctacctt
gcagttaatggagagatctacaattaccgtcagctgcgtgcttcactcaactcgtctgtt
gagttcaagactgacagtgactgtgaagtgatcatgtatctgtaccgcgagcacggagtc
gatttcgtcaacatgcttgacggcatgtttgcattcatcctcctcgacacaagcgtgtcg
ccacaccgcgtcattgccgcgcgtgatccaattggtgtgacgaccttgtactatggccgt
tccttcgaatatccgggtgcattgtacttttcgagcgagttgaaggccatttcaaaagag
tgcgagcgcttgttttcatttccgccaggtcatttctatgacagtcaaagggcgaaaggc
gatgaactcgtgcgctactaccgcccatcttggtgggacacggacgagtctggtcaactt
cctacggccaccgcggatcttgcgctcatccgcacgacacttgagaaggccgtacgaaag
cgtctgatgagtgaagttgcttatggtgtactcctatccggtggactggactcgtcgctc
attgcagccattgcggcgcgagagacagagaagcaggctaaggtgcagcagatggaattg
gaacatgcacatcacgaggcagctgtcgcatcaaagacggaaccgcgtagcagcaaggtg
cgtcgcacggagcatgcctctgatgcgaccaagaccagtgacgacgggccgctcgttgct
tggccgcgtctgcactcgttctccattggcttgcctgggtcgccagatctccttgcagct
cgacaggcagccgagttccttggcacaatccatcacgaatacaccttcaccgtgcaagag
ggacttgatgcactctcagatgtcgtgtatcatctcgagacatacgacgtcacgacagtg
cgtgcatctacccccatgtacctgctctctcgcaagataaaagcaacaggcgtaaaaatg
gtcctgtcaggcgagggctctgacgaggtgtttggcggttacctgtacttccatgcggcc
ccgagcaaggaggcctttcatcaagagtctgtgaagcgtgtgaagaacctgcacacggcc
gactgcctccgagccaacaagagtacgatggcttggggtttggaggcccgtgtgccgttc
cttgacaaggcattcctcgacgtgtgtatgaatttggatcccgcacagaagcaattctcc
aagggtagtctgcagaagaaggatgctgatggccgaccgtacatggaaaagtacattttg
cgcaaggcttttgacgtgaagccggatgatttggagcacggttcgccattggaaggcagt
ctgccatacctgccagaaagcattctttggcgccagaaggagcagttcagcgatggtgtg
ggttattcgtggatcgatggaatgaaggagtatgcggaaaagactgtcagcgatgacaag
ttcagtgagcgcgagagtcgatacccagtcgacacgccggatacgaaggaggcgtacatg
attcgagaactgtttgagtcatggttcccgacggaagcagccgcccggacggctgtgcgc
tgggtccctcgtggtgactggggctgctcaagtgacccgtctggacgaagtgtggcgatt
cacgatgctgcttatcaacaacaagaggtagctgcagctgaggtcggtcagggcggtgcc
taa

DBGET integrated database retrieval system