KEGG   Malassezia globosa: MGL_0575Help
Entry
MGL_0575          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mgl  Malassezia globosa
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mgl04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:mgl04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:mgl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MDPDHVDARRLVALCHLMGGTALVFPFAPSSFGHVRVPHGYQARPPSRASALSVMHLLQR
GSRATFQDIGSARVYASACTALGQYKDAHDALEYTIQHGTKRKQADMPPACSFPSRDVYT
SQLYTQLGHMSMKQAKYTEAANYFGRAHELDPLNWGAWTSLCDMATARPAADAWLVKPRV
SAATSSGTTAPTTAAASAPASKLQQTKRARAPEPSTRPVRRVTPRAAALRSGMARGASAH
AHQPTSAPLHETHGPPVSTSVPPRTLSSSRTHVTRPLPQEDARKRVPSKTGLTGLSSTSV
ARGTSTRAASSAPLAPDQTTSPTGMVLELTRDLAEAYRLVRRYEGAKAVALLCDNTQAPP
RRRAFRIACVYCLLGRALHDMTEYTDAETQFRRARALEPYLLMHMDIYSLVLFQLHREVA
LSALAQDLLAMDPRAAVAHIAAGNTWSLQHQHDAAYQCFRQATLVAPECAYAYTLAGYEA
LELEQPARAVRLFRCARRCDRRHWNALAGLGQVYLRQGHAVRASEAYAQAFLINRSNAVL
LDLLGWALEQSGNWNGALAVYQRAIAMQPKAAMTRLKKAQLLLRLARACDDTDGTPLLDK
RERARQRQAAHAELLRVCALAPSEPRVHLMLARSYMRMGGGRFAPGEDTTPPGSPGGDSD
AERSSGLGATQHGTRLPKAFHAEITHHLATAVDLDPRCVREVNAMGDMPKLAWHGLMGGP
GFATGSGAGAMSGDVGAMIAEDDDIDDMAGIEDSQDMADIATNMAYHAIDQDDELDGYVW
EG
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggatccagaccacgttgatgcgcggcgtctagttgctctttgccaccttatgggtgga
accgcgctagtttttccttttgctccgtcgtcatttggtcatgttcgcgtgcctcatggt
taccaagcgcgtccgccttcgcgagcatccgcattgtctgtaatgcacctcctacagcga
ggatcccgcgccacgttccaagacataggatctgcgcgcgtatatgcatcagcatgtacg
gctcttgggcagtacaaggatgcgcacgatgcgctcgagtatacgatccaacatggcacg
aaacgcaagcaggcagacatgccacctgcatgctcgttcccctcccgtgacgtgtacacg
agccagctctatacacaattgggccatatgtctatgaagcaggccaagtacacggaggcg
gccaactacttcggcagggctcacgaactagacccgttgaattggggtgcatggacctcc
ctttgtgatatggcaacagcgcgtcctgctgccgatgcatggttagtgaagccacgcgtc
tcagctgccaccagcagtggaacaacagcaccgacaacagctgctgcctccgctcctgct
tccaagctgcagcaaacgaaacgggcgcgtgcgccagagccaagtacgcgccctgtgcgt
cgagtcacgccacgggcggctgcgttgcgttcgggcatggctcgaggagcaagtgcacat
gcccatcagccaacaagcgcgcctttgcatgaaacacatggaccccctgtatctacgtct
gtgccgccacgcacactttcttcgtcgcggactcatgtcactcggccgctgccacaggaa
gacgcccgcaagcgcgtaccaagcaagacgggcctgacgggcctgagcagtacatctgta
gcccgagggacgagcactcgtgctgcatcgtcagcaccgctcgctcccgaccaaaccact
tcgccaaccggcatggtgcttgagttaacgcgtgacttggccgaagcctatcgcttggtc
cgtcgatacgagggagcgaaggcggtggccttgttgtgcgacaacacacaggcgccgccg
cgccgccgtgcattccgcatagcttgtgtctactgcttgctagggcgtgctttgcatgac
atgacagagtacacagacgcagagacccagttccgtcgtgcacgtgctctcgagccgtac
ttgctgatgcacatggacatctactcgttggtcctgtttcagctgcaccgagaagtcgcc
ctgtcggcactggcccaagatctgcttgcgatggacccacgtgccgctgttgcccacatt
gctgcgggcaatacatggtcgctccaacaccaacatgatgctgcctatcagtgttttcgg
caagccacgctcgtcgcgcctgagtgtgcatatgcatacaccctggcaggctacgaggct
cttgaactcgagcagccagcgcgtgctgtgcgcttgttccgctgtgcacgtcgatgcgac
cgacgccattggaatgcgctcgccggcctcggtcaggtgtaccttcggcagggccatgcc
gtccgtgcgagcgaagcatatgcacaagcatttctaatcaaccggagtaatgccgtgctg
ctcgacctacttggatgggcgcttgagcagtctggcaactggaacggtgcattggccgtg
taccaacgagccattgccatgcagcccaaagccgccatgacacggctcaagaaagcacaa
ctccttcttcgccttgcgcgtgcgtgtgacgataccgatggcacgccattgctcgataaa
cgtgaacgtgcacggcagcgccaggcagcccatgctgagctcctgcgcgtctgtgcatta
gcaccatcagagcctcgtgttcacttgatgctcgctcgctcgtacatgcgaatgggtggg
ggacgctttgctcccggcgaagataccactcctccaggctctcctggtggggacagtgat
gcagagcgtagcagcggcctcggcgcgacccagcacggaacacgattgccgaaagcattt
cacgcagagattacgcaccacctcgcgacagccgtggatcttgatccgcgatgcgtgcga
gaagtgaatgcgatgggagatatgccgaaactcgcttggcacggccttatgggaggccct
ggtttcgcgacaggttctggagctggcgctatgagtggtgacgtcggagccatgattgct
gaggacgacgacattgatgacatggcaggtatcgaagattcccaagatatggccgacata
gccacgaacatggcataccatgccattgaccaagacgacgagctggatggctacgtatgg
gaaggctaa

DBGET integrated database retrieval system