KEGG   Malassezia globosa: MGL_0575Help
Entry
MGL_0575          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mgl  Malassezia globosa
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    MGL_0575
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    MGL_0575
   04113 Meiosis - yeast
    MGL_0575
Protein phosphatases and associated proteins [BR:mgl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MGL_0575
Ubiquitin system [BR:mgl04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     MGL_0575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MDPDHVDARRLVALCHLMGGTALVFPFAPSSFGHVRVPHGYQARPPSRASALSVMHLLQR
GSRATFQDIGSARVYASACTALGQYKDAHDALEYTIQHGTKRKQADMPPACSFPSRDVYT
SQLYTQLGHMSMKQAKYTEAANYFGRAHELDPLNWGAWTSLCDMATARPAADAWLVKPRV
SAATSSGTTAPTTAAASAPASKLQQTKRARAPEPSTRPVRRVTPRAAALRSGMARGASAH
AHQPTSAPLHETHGPPVSTSVPPRTLSSSRTHVTRPLPQEDARKRVPSKTGLTGLSSTSV
ARGTSTRAASSAPLAPDQTTSPTGMVLELTRDLAEAYRLVRRYEGAKAVALLCDNTQAPP
RRRAFRIACVYCLLGRALHDMTEYTDAETQFRRARALEPYLLMHMDIYSLVLFQLHREVA
LSALAQDLLAMDPRAAVAHIAAGNTWSLQHQHDAAYQCFRQATLVAPECAYAYTLAGYEA
LELEQPARAVRLFRCARRCDRRHWNALAGLGQVYLRQGHAVRASEAYAQAFLINRSNAVL
LDLLGWALEQSGNWNGALAVYQRAIAMQPKAAMTRLKKAQLLLRLARACDDTDGTPLLDK
RERARQRQAAHAELLRVCALAPSEPRVHLMLARSYMRMGGGRFAPGEDTTPPGSPGGDSD
AERSSGLGATQHGTRLPKAFHAEITHHLATAVDLDPRCVREVNAMGDMPKLAWHGLMGGP
GFATGSGAGAMSGDVGAMIAEDDDIDDMAGIEDSQDMADIATNMAYHAIDQDDELDGYVW
EG
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggatccagaccacgttgatgcgcggcgtctagttgctctttgccaccttatgggtgga
accgcgctagtttttccttttgctccgtcgtcatttggtcatgttcgcgtgcctcatggt
taccaagcgcgtccgccttcgcgagcatccgcattgtctgtaatgcacctcctacagcga
ggatcccgcgccacgttccaagacataggatctgcgcgcgtatatgcatcagcatgtacg
gctcttgggcagtacaaggatgcgcacgatgcgctcgagtatacgatccaacatggcacg
aaacgcaagcaggcagacatgccacctgcatgctcgttcccctcccgtgacgtgtacacg
agccagctctatacacaattgggccatatgtctatgaagcaggccaagtacacggaggcg
gccaactacttcggcagggctcacgaactagacccgttgaattggggtgcatggacctcc
ctttgtgatatggcaacagcgcgtcctgctgccgatgcatggttagtgaagccacgcgtc
tcagctgccaccagcagtggaacaacagcaccgacaacagctgctgcctccgctcctgct
tccaagctgcagcaaacgaaacgggcgcgtgcgccagagccaagtacgcgccctgtgcgt
cgagtcacgccacgggcggctgcgttgcgttcgggcatggctcgaggagcaagtgcacat
gcccatcagccaacaagcgcgcctttgcatgaaacacatggaccccctgtatctacgtct
gtgccgccacgcacactttcttcgtcgcggactcatgtcactcggccgctgccacaggaa
gacgcccgcaagcgcgtaccaagcaagacgggcctgacgggcctgagcagtacatctgta
gcccgagggacgagcactcgtgctgcatcgtcagcaccgctcgctcccgaccaaaccact
tcgccaaccggcatggtgcttgagttaacgcgtgacttggccgaagcctatcgcttggtc
cgtcgatacgagggagcgaaggcggtggccttgttgtgcgacaacacacaggcgccgccg
cgccgccgtgcattccgcatagcttgtgtctactgcttgctagggcgtgctttgcatgac
atgacagagtacacagacgcagagacccagttccgtcgtgcacgtgctctcgagccgtac
ttgctgatgcacatggacatctactcgttggtcctgtttcagctgcaccgagaagtcgcc
ctgtcggcactggcccaagatctgcttgcgatggacccacgtgccgctgttgcccacatt
gctgcgggcaatacatggtcgctccaacaccaacatgatgctgcctatcagtgttttcgg
caagccacgctcgtcgcgcctgagtgtgcatatgcatacaccctggcaggctacgaggct
cttgaactcgagcagccagcgcgtgctgtgcgcttgttccgctgtgcacgtcgatgcgac
cgacgccattggaatgcgctcgccggcctcggtcaggtgtaccttcggcagggccatgcc
gtccgtgcgagcgaagcatatgcacaagcatttctaatcaaccggagtaatgccgtgctg
ctcgacctacttggatgggcgcttgagcagtctggcaactggaacggtgcattggccgtg
taccaacgagccattgccatgcagcccaaagccgccatgacacggctcaagaaagcacaa
ctccttcttcgccttgcgcgtgcgtgtgacgataccgatggcacgccattgctcgataaa
cgtgaacgtgcacggcagcgccaggcagcccatgctgagctcctgcgcgtctgtgcatta
gcaccatcagagcctcgtgttcacttgatgctcgctcgctcgtacatgcgaatgggtggg
ggacgctttgctcccggcgaagataccactcctccaggctctcctggtggggacagtgat
gcagagcgtagcagcggcctcggcgcgacccagcacggaacacgattgccgaaagcattt
cacgcagagattacgcaccacctcgcgacagccgtggatcttgatccgcgatgcgtgcga
gaagtgaatgcgatgggagatatgccgaaactcgcttggcacggccttatgggaggccct
ggtttcgcgacaggttctggagctggcgctatgagtggtgacgtcggagccatgattgct
gaggacgacgacattgatgacatggcaggtatcgaagattcccaagatatggccgacata
gccacgaacatggcataccatgccattgaccaagacgacgagctggatggctacgtatgg
gaaggctaa

DBGET integrated database retrieval system