KEGG   Malassezia globosa: MGL_0646Help
Entry
MGL_0646          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
mgl  Malassezia globosa
Brite
Exosome [BR:mgl04147]
 Exosomal proteins
  Proteins found in most exosomes
   MGL_0646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQGYVDNNLVGTGKVSMAAIIGLKGGVWASSPGLNVSMEEQTAIIKGLDDPSPLQANG
IFVSGKKYLTLQANPRSIYGKAGGDGLCVVRTNQAVLIGIYNSPLLPGDANKVVEGLADY
LISVGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcagggatatgtcgacaacaacctcgttggaactggcaaagtttctatggct
gcaattattggtctgaaaggcggagtttgggcgtcttctcctggattgaatgtaagcatg
gaggaacagacggccattatcaagggtctcgatgacccgtcgcctcttcaggccaacggc
atatttgtgtctggtaagaagtacttgacattgcaagcaaatccacgttcgatctacgga
aaagccggaggcgatgggttatgtgttgtgcgcacaaaccaagctgtactgattggtatt
tacaattcgcccctactccctggcgatgcgaacaaagtcgttgagggtcttgcagactac
ctgatttccgtagggtactaa

DBGET integrated database retrieval system