KEGG   Malassezia globosa: MGL_0647Help
Entry
MGL_0647          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgl  Malassezia globosa
Pathway
mgl00010  Glycolysis / Gluconeogenesis
mgl00051  Fructose and mannose metabolism
mgl00562  Inositol phosphate metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01130  Biosynthesis of antibiotics
mgl01200  Carbon metabolism
mgl01230  Biosynthesis of amino acids
Module
mgl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgl_M00002  Glycolysis, core module involving three-carbon compounds
mgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGL_0647
   00051 Fructose and mannose metabolism
    MGL_0647
   00562 Inositol phosphate metabolism
    MGL_0647
Enzymes [BR:mgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MGL_0647
Exosome [BR:mgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MGL_0647
  Exosomal proteins of bladder cancer cells
   MGL_0647
  Exosomal proteins of melanoma cells
   MGL_0647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 5856367
NCBI-ProteinID: XP_001732054
UniProt: A8PUB9
AA seq 248 aa AA seqDB search
MSRTFFVGGNWKMNGSIEQYQSLIKHLLDSSLDSKAEVVIAPPSLYLLPSQKLLEGKQIA
LGAQNAYNKPSGAFTGEISVAQLKDASIPWVILGHSERRSIFGETDDMVAQKTSAALETG
LSVILCVGESLEQREKNESINVVLGQLETATKDVKDWSKIVIAYEPVWAIGTGKVATAEQ
AQEVHAAIRQWLVKKADQQVSDTLRIIYGGSVAAKNCKELASQPDIDGFLVGGASLKPEF
VDIVNARL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtactttctttgttggtggcaactggaagatgaacggctcgatcgagcagtac
cagagcctaatcaagcatctgctggattccagcctggattcgaaagctgaggttgtgata
gctcccccatcgctgtacctattgccatcgcagaagcttcttgagggcaagcaaatcgcg
ttgggcgcccagaatgcttacaacaagccatctggtgcattcacaggagagatctctgtt
gctcagctcaaagatgctagcattccttgggtgattcttggccattctgaacgccgctct
attttcggcgagacggatgatatggtggctcagaagacgtcggccgctctcgagactggt
ctctctgtgattctttgcgttggtgagtcgcttgaacagcgtgagaagaacgagagtatc
aacgttgtcctgggtcagcttgagacggccacaaaggacgtcaaggattggagtaagatt
gtgattgcttacgagccggtatgggcaatcggcactggcaaagttgctacggccgagcag
gctcaggaagtccacgctgccatccgtcagtggctcgtcaagaaggctgaccagcaggtg
tctgacacgctgcgtatcatctacggaggtagtgtggctgctaagaattgcaaggagctc
gcctcccagccagacattgatggcttccttgtcggcggagcaagtctgaagcctgaattt
gttgacattgtgaacgctcgtctgtag

DBGET integrated database retrieval system