KEGG   Malassezia globosa: MGL_0721Help
Entry
MGL_0721          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mgl  Malassezia globosa
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mgl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mgl00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 165 aa AA seqDB search
MVTFYELKAAMPQGKSFDFAQLKGKVVLIVNTASKCGFTPQFEGLEKLYKDYSPRGLMVL
GFPCNQFMSQDPGDDESIGGFCMKVRLLVGNPRSEAVGAGKGQYFIRTFMTDTVVFQNYG
VSFPIMAKSDVNGEHANETFKFLKHEQPGLFGSEMISTYSHHWIV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattctatgaattgaaagcagcgatgccgcagggcaagtcgttcgactttgcc
cagttgaaaggcaaggttgtcttgatcgtgaatacggcaagcaagtgtggctttactccg
caattcgagggcttggagaaattgtacaaggactactcgccgcgtggattgatggtactg
ggattcccatgtaatcagttcatgtctcaggatcctggcgatgatgagagcattggtgga
ttttgcatgaaggtacgtttgctggtaggaaacccacgatcagaggcggtgggagctggg
aaggggcagtactttattagaactttcatgactgacacggttgttttccagaactatggc
gtctcattccccatcatggccaagtcggacgtcaacggcgagcatgcgaacgaaacgttc
aagttcctgaagcatgagcaaccaggattgtttggctctgaaatgatcagtacgtactca
catcattggattgtctaa

DBGET integrated database retrieval system