KEGG   Malassezia globosa: MGL_0777Help
Entry
MGL_0777          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
mgl  Malassezia globosa
Pathway
N-Glycan biosynthesis
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    MGL_0777
   00513 Various types of N-glycan biosynthesis
    MGL_0777
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MGL_0777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MLVTCMRLTRSIFLVYAGLFFLTSLSACIAAATEWTQDSFSKIMELGGAVGLLNLEIKAT
PAEIGTNGVATYLLYLTKYEHEHLSMLTASLVQEDDDSQELDLEITPLGALEFDHDTIQY
AIDVPMEKVKAVNLLVNAVFLHITSPLPKELEQGEHQMLLWNGDAEPRTPYATSSASVSI
RTPDPIITIDSSVGSKRNDNTVEFGPFNDVRAYTLESQPVAQGRVHFTYSRPVIAFVDYK
RHVEVSHWGDNMATQDSILLRNVGPKLKGHFSRSLHMINMHMNPLAERVSQVQSLPLYLP
SGAKDVYFVDATGNVSTSSLSPTPKMLGMPRRLDIRPRFPVLGGWNYSFTVGWNERMSQH
GIARWNPAKPWRTRIAVPFLISPKTAAIDVANLTIALPEGATDIQVMLPFQVDSMETSTY
PTYLDTVGRPIVSISRAKCSFMNSKVVFVEYTLPLSSYARKPLCVALAVLLVFFASAFVS
RQVTPTQHMK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgacgtgcatgagactgacacgctccatcttcttggtgtacgcaggactcttt
ttcctcacgagtctatctgcttgtatcgctgctgcgacagaatggacgcaagactcgttc
tccaagatcatggagctcggaggtgcggtgggtctcctaaaccttgagatcaaggcaaca
cctgccgagattggtacaaatggtgttgcaacataccttctatacctcactaagtacgag
catgaacatttatcgatgcttacagcatcgctggtgcaagaggatgacgacagtcaagaa
ctggacctcgaaatcactcctttgggtgcattggaatttgaccatgatacgatccagtat
gccatcgatgtacccatggagaaggtaaaagcagtgaatttactagtaaacgctgtgttt
ttgcacattacatcgccgttgccgaaagagttggaacagggcgagcaccaaatgctgcta
tggaacggtgatgccgagccacgcacgccatacgctacgtcgtctgcgtctgtctcaata
cgcacacctgaccctattatcactattgattcttctgtgggatctaagcgtaatgacaac
actgtcgagtttggtccgttcaacgatgtccgtgcttacacgctggagtctcaacctgtt
gctcaaggacgcgttcactttacttacagcagacctgtcattgcattcgtggactacaaa
cgacatgttgaagttagccactggggtgataatatggcaacacaagattccattttgttg
cgcaacgtcgggcccaaactcaagggccatttcagccgctccctgcacatgatcaacatg
cacatgaatccattggctgaaagagtttcgcaggttcaatctcttccgctttatctcccc
tctggcgcaaaagatgtgtacttcgttgatgcaacaggcaatgtgtcgacttcatccttg
tcaccgacacccaaaatgctaggtatgccacgccgtttagatatccgaccacgctttcct
gtgcttggtgggtggaactattcatttactgttggctggaatgagcggatgagccagcac
ggtattgctcgttggaatccagcaaaaccttggcgtacgcgcattgccgttccgtttctg
atttcccccaagacagccgccattgatgtggctaatctcacgattgctcttcctgagggt
gcaaccgatattcaagtaatgctgcccttccaggtagactcgatggagaccagcacgtat
ccaacgtacctggacacagtgggacgccctatcgtatctatttcgcgcgcgaaatgctct
ttcatgaacagcaaagtcgtatttgtggaatacactttgcctttatcaagctatgcccgc
aaaccgttgtgtgtggctctagctgtcctgctagtgttcttcgcatcggcctttgtgagt
cgtcaagtgactccaacacagcacatgaaataa

DBGET integrated database retrieval system