KEGG   Malassezia globosa: MGL_0801Help
Entry
MGL_0801          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgl  Malassezia globosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGL_0801
   01230 Biosynthesis of amino acids
    MGL_0801
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGL_0801
   00030 Pentose phosphate pathway
    MGL_0801
   00051 Fructose and mannose metabolism
    MGL_0801
   00052 Galactose metabolism
    MGL_0801
  Energy metabolism
   00680 Methane metabolism
    MGL_0801
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MGL_0801
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MGL_0801
Protein phosphatases and associated proteins [BR:mgl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MGL_0801
Messenger RNA biogenesis [BR:mgl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MGL_0801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 761 aa AA seqDB search
MAIYHGYETFVIREGFAGLVKGNQESTSNETRAKMNPRMVNDVPLSYGCGDFFRLGDLED
GDSNYHNQYIIQVGWDDVRGWENQGGTLIGSARCKEFLQREGRLNAAYNLISHGISSLVI
CGGDGSLTGADILRQEWPSLLESLIDQDRISAEQAHSFCQLHIVGLVGSIDNDLTSTDLT
IGSSTALLRICEALDAISSTASSHSRAFVVEVMGRHCGWLALMAGIASGADYIFVPERPP
PDDWRAHLRESLLSIRDKGKRKSIVIVAEGAIDRELQPIKANMVAEVLSQDLHLDTRVTM
LGHTQRGGLPDANDRILATLQGIDALKVLLEDEPSKPAYIIGIREGRIKRLPLRESIERN
NLLPKAIADKRFEDAQDARGTDFRASFDTFTYNAAASSAHHKPREALCIGIMHVGAPAGG
MNSATRTAVRFCLRRGHTALLIHNGFSGLLKGIITKASWLRVDSWATSGGSELGTNRTLP
IENLDGVAEQLQKHNIQALLIIGGFETFTSIKILSEARSKYAAFRIPLLGIPATLSNNVP
MNENAIGAHTSLDVMVNACDMIIQSASASRNRVFVVEVQGGQCGFLAVMGALAVSAAVVY
TPEDGVTLQQLNCDIQFMRRRFNYDPEYVNDGRIVICNERASSIYTAQTIAKIYGEEGAG
IFDCRYERLSHVLQGGTPAPLDRVHAARVAVQCCEFLEKHAGSASAWDPPSAIITVRQAS
TIITPISQMVNSSDFTNRRGTDIWWSHCKEYVEIISGQKFL
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggctatttaccatggttatgaaacatttgtgattcgtgaaggattcgctggtctagtg
aaaggaaaccaagagagcacaagcaatgagacgcgagctaaaatgaacccacgtatggtc
aatgacgtgcctctttcgtatggatgtggtgactttttccgtctcggtgatctggaggat
ggtgactcgaattatcataaccagtacatcattcaagttggttgggatgacgttcgaggg
tgggagaaccaaggcggtaccttgattggatctgcacgttgcaaagaatttttgcaaaga
gagggccgtctgaatgcagcgtacaatctcatcagtcatggaatttcttcgcttgtgatt
tgcggtggtgacggcagtttaactggtgccgatattcttcgacaggaatggccttctttg
ctagaatcactcattgaccaagaccggatttcagcagaacaagcgcattcattctgtcaa
ttacacattgttggtctagtgggctctatcgacaatgatttgacaagcacggatttgaca
attggctcttcaacagccttgctccgcatatgtgaggctctcgatgcaatatccagcaca
gcttcttcacatagccgtgcatttgttgttgaagttatgggtcgacattgcggatggcta
gcactcatggctggcattgcatcaggcgctgattatatattcgtacctgaacgcccacca
ccagacgactggcgtgcacatcttcgcgagtcattgctttcgattcgcgataagggtaaa
cgaaagtcaattgtaatcgttgcagaaggtgccattgatcgggagttacaacccatcaag
gcaaatatggtggcagaagttttatcgcaagacttgcatttggacactcgcgttactatg
ctggggcacacgcagcgaggtgggcttccggatgcaaacgatcgtattttggccactctg
caagggattgatgctttaaaggtgcttctggaggatgagccaagtaaaccagcgtatata
attggaattcgcgaggggagaatcaaacgccttccgttgcgcgaatcgatcgagcgaaac
aatttgcttccaaaggcaattgcagacaaacgcttcgaagatgcacaggatgcgcgtggg
actgactttcgtgctagtttcgacacattcacttacaatgccgccgcgtcatctgcccac
cacaagccaagggaggcattatgcatcggtattatgcacgttggagcaccagctggtgga
atgaatagcgctactcggacagctgttcgcttctgcttgcgccgcggtcacacagccttg
ttgattcataatggattttccggtcttcttaagggcattattaccaaagcaagctggctt
cgagtggattcatgggcaacctctggtggttccgaattgggtacaaatcgcacattaccg
attgaaaacctcgatggtgtggcagagcagttgcagaaacacaacatccaggcacttttg
atcatcggagggttcgagaccttcacctccataaaaattttgagtgaggctcgatcaaag
tacgcagcatttcgaatcccccttcttggcattccagcaacattatcaaataatgtgccc
atgaatgaaaatgcaattggtgcacatacatcactcgatgttatggtgaatgcttgtgat
atgattatccagtctgcgtcagcgtctcggaatcgtgtttttgttgtggaagtacaaggc
ggtcaatgtggttttttggcagttatgggcgcactcgccgtttcggcggctgtcgtctat
acgccggaagatggcgtcacgttgcaacaactcaactgtgatatacagttcatgcgccga
agattcaactatgatcctgaatatgtcaatgatggtcgcatcgtgatttgcaatgagagg
gcttcctccatatatacggcccaaacaatcgctaagatatatggcgaggaaggtgcaggc
atattcgactgtcgctacgagcgactaagccacgttttgcaaggtggcacacctgctccg
ctcgatagggttcatgcagctcgagtcgctgtgcagtgttgtgaatttttggaaaagcac
gctggttctgcctcggcatgggacccaccatccgcaatcataactgtgcgtcaagccagc
accatcataacgcctatctcgcaaatggttaattcgtccgattttactaatcgacgtggt
acggacatatggtggagtcattgcaaagagtacgtagagatcatcagcggacagaaattc
ttgtag

DBGET integrated database retrieval system