KEGG   Malassezia globosa: MGL_0846Help
Entry
MGL_0846          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MGL_0846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MALLRNLCRLSSRSVRATTTPRAASAFFPRASVRTYSTSPQESKPAAPPSGSGSNVPLLL
AVLLAAGAGGAYFLSDDVKNWVNGATSTKTNPTKEDYQAVYNEIAKSLEKDSSYDDGSYA
PVVLRLAWHSSGTYDKNNNTGGSNGATMRFKPEASHGANAGLENARKFHEPIKAKFPWIS
YSDLWTLGGVVAVQEMGGPTILWRPGRVDKPVEDTPPDGRLPDGAQGQKHLRDVFHRLGF
NDKETVALAGAHAVGRCHSNHSGFEGPWTFSPTSFTNQFYVMLLDESWEPKKWDGPFQYV
DKSSGSLMMLPTDYSLIKDSTFKKYVQEYAKDEQKFFKDFADVFARLLELGVPAENFEKA
ASSLGTKEPLKFKVLADQEK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctttgttgcgaaacctctgccgtttgtcgtcgcgtagtgtgcgcgccacgacgacg
ccacgagcagcttcggctttctttccccgtgcaagcgttcgaacatacagcacgtctccg
caagagtccaagcctgcagcgccgccgtctggctcaggctcaaatgttccattgcttctt
gccgtgctgctggctgctggtgcgggtggtgcgtacttcctaagcgacgatgtgaagaac
tgggtaaacggtgccacttcaacaaagacaaatccgacaaaagaggactatcaggctgtc
tacaatgaaattgcgaaatcacttgaaaaggactcgtcatatgatgatggcagttatgcg
ccagttgtgcttcgtcttgcgtggcactcgtctggcacgtacgacaagaataacaacacc
ggcggtagcaatggtgcaacgatgcgctttaagccggaagctagccatggtgctaatgct
ggtctggagaatgcccgcaagttccacgagccaattaaggccaagttcccgtggatctcg
tactcagacttgtggacattgggtggcgtcgttgctgtccaggagatgggcggtccgaca
atcctgtggcgcccaggtcgtgttgacaagccagttgaggacacgccccctgacggccgt
ttgcccgatggcgcccagggccagaagcacctgcgtgatgtattccatcgcttgggcttt
aatgacaaggaaactgtggctctggctggcgctcatgcagtgggccgttgccatagcaac
cactctggtttcgaaggcccatggacgttctcgccaacttcgttcacgaaccagttctat
gtcatgctgcttgacgagtcctgggagcctaagaagtgggatggtcctttccagtatgtc
gacaagagctctggctcgctgatgatgttgccgacggactattctctcatcaaggacagc
actttcaagaagtacgtgcaggaatacgccaaggacgagcagaagttcttcaaggacttc
gctgatgtatttgcaaggctgctcgagctaggtgtgcctgcggagaactttgagaaggct
gcgtcgagtctgggaaccaaggagcctctgaagttcaaggtccttgctgatcaggagaag
taa

DBGET integrated database retrieval system