KEGG   Malassezia globosa: MGL_0893Help
Entry
MGL_0893          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgl  Malassezia globosa
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGL_0893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGL_0893
   00020 Citrate cycle (TCA cycle)
    MGL_0893
   00620 Pyruvate metabolism
    MGL_0893
Enzymes [BR:mgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MGL_0893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MYAIVRQQMLRAGSLMRTSAAYLHTSTAARELSKFTMPAMSPTMQDGGIAAWRKKEGESF
NGGDVLLEIETDKATMEVEAQDDGVLAKIIADAGSKNVPVNSTIAIIGEEGDDLSGADAL
AKEAESESASASAGEAEKAAKQEESAKEEESKQKEAKSEEEDKPAAPKPRESDDSGTASK
LASMDHLSASPIAKRIALERGIPLLQVKGSGPNGRIVKEDVEKFASGSGAAAAAATASTA
AAGGSAPAYTDQPLSNMRRTIAKRLTESKSTVPHYYVTFDIEMARVLQLREVFTRASAEA
ARGDEAKAKQAKLSVNDFIVKAAALALKQVPAANSAWHGEYIREYHTQDISMAVATPNGL
ITPIIRNCGAIGLTEIGKQSKELAKKARDGKLKPEEYQGGTFTISNMGMMGTSHFTAIIN
PPQSCILAIGATEARLVPDESTDKGFRTVQVMKATISADHRVVDGALAAQWMQAFKAALE
NPLSFML
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcaattgtgcgacagcagatgcttcgagcgggctcgctcatgcgcacgagtgca
gcctacctgcacacaagcacggctgcgcgtgagttgagcaagtttacgatgcctgcgatg
agtccaactatgcaagatggtggcattgctgcgtggcggaaaaaggagggcgagtcgttc
aacggcggtgatgtgttgctcgaaatcgaaacagacaaggcgacgatggaagtggaagca
caggacgacggtgtgctggccaaaattattgccgacgcaggctcgaagaatgtgccagtg
aactcgaccatcgctattattggtgaagaaggcgatgacttgtcgggtgcagatgcgctt
gcaaaggaggcagagagtgaatcggcctcggcatcggccggcgaagcagaaaaggcggct
aaacaagaggagagtgcgaaggaggaagagtcgaagcagaaagaggccaagagcgaggag
gaggacaagccggcagcgcccaagccccgcgagagtgacgacagcggcacagcttcgaag
ctcgcatcgatggaccatttgagtgcgagtcctatcgcgaagcgcattgctcttgaacgg
ggtattcctctgttgcaggtgaagggctcgggacccaatggccgcattgtgaaggaggac
gtggagaagtttgcctcaggctcgggagccgccgccgccgccgccacggcgtccaccgcc
gctgcaggtggcagtgcgccagcgtacacggatcagcccctgtcgaacatgcgtcgtacc
attgccaagcgcctgaccgagagcaagtcgacggtgccgcactactatgtcacgtttgat
attgagatggcccgtgttctgcagttgcgcgaagtgttcacccgtgcgtcggcagaggca
gcgcgtggcgacgaggccaaggcgaagcaggcgaagctgtcggtgaatgactttatcgtc
aaggctgcggcgttggctctgaagcaagtgccggcggctaactcggcgtggcacggcgag
tatattcgtgagtaccacacacaggacattagtatggccgtcgctacgccgaacggcctc
attacgccgatcattcggaactgcggcgcgattggtcttaccgagattggcaagcagagc
aaggagctcgccaagaaggcgcgcgacggcaagctgaagccggaagaataccagggcggc
acgttcacgatttcgaacatgggcatgatgggcacgtcccacttcacggcgatcatcaac
ccgccgcagagctgtatcttggcgatcggcgcgacagaggcacgccttgtgccggacgag
tcgacggacaagggcttcaggaccgtgcaggtgatgaaggcgacgatctcggcggaccac
cgcgttgtcgatggtgcgttggccgcccagtggatgcaggcattcaaggcagcgctcgag
aacccactctcgtttatgctgtga

DBGET integrated database retrieval system