KEGG   Malassezia globosa: MGL_0893Help
Entry
MGL_0893          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgl  Malassezia globosa
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mgl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgl00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MYAIVRQQMLRAGSLMRTSAAYLHTSTAARELSKFTMPAMSPTMQDGGIAAWRKKEGESF
NGGDVLLEIETDKATMEVEAQDDGVLAKIIADAGSKNVPVNSTIAIIGEEGDDLSGADAL
AKEAESESASASAGEAEKAAKQEESAKEEESKQKEAKSEEEDKPAAPKPRESDDSGTASK
LASMDHLSASPIAKRIALERGIPLLQVKGSGPNGRIVKEDVEKFASGSGAAAAAATASTA
AAGGSAPAYTDQPLSNMRRTIAKRLTESKSTVPHYYVTFDIEMARVLQLREVFTRASAEA
ARGDEAKAKQAKLSVNDFIVKAAALALKQVPAANSAWHGEYIREYHTQDISMAVATPNGL
ITPIIRNCGAIGLTEIGKQSKELAKKARDGKLKPEEYQGGTFTISNMGMMGTSHFTAIIN
PPQSCILAIGATEARLVPDESTDKGFRTVQVMKATISADHRVVDGALAAQWMQAFKAALE
NPLSFML
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcaattgtgcgacagcagatgcttcgagcgggctcgctcatgcgcacgagtgca
gcctacctgcacacaagcacggctgcgcgtgagttgagcaagtttacgatgcctgcgatg
agtccaactatgcaagatggtggcattgctgcgtggcggaaaaaggagggcgagtcgttc
aacggcggtgatgtgttgctcgaaatcgaaacagacaaggcgacgatggaagtggaagca
caggacgacggtgtgctggccaaaattattgccgacgcaggctcgaagaatgtgccagtg
aactcgaccatcgctattattggtgaagaaggcgatgacttgtcgggtgcagatgcgctt
gcaaaggaggcagagagtgaatcggcctcggcatcggccggcgaagcagaaaaggcggct
aaacaagaggagagtgcgaaggaggaagagtcgaagcagaaagaggccaagagcgaggag
gaggacaagccggcagcgcccaagccccgcgagagtgacgacagcggcacagcttcgaag
ctcgcatcgatggaccatttgagtgcgagtcctatcgcgaagcgcattgctcttgaacgg
ggtattcctctgttgcaggtgaagggctcgggacccaatggccgcattgtgaaggaggac
gtggagaagtttgcctcaggctcgggagccgccgccgccgccgccacggcgtccaccgcc
gctgcaggtggcagtgcgccagcgtacacggatcagcccctgtcgaacatgcgtcgtacc
attgccaagcgcctgaccgagagcaagtcgacggtgccgcactactatgtcacgtttgat
attgagatggcccgtgttctgcagttgcgcgaagtgttcacccgtgcgtcggcagaggca
gcgcgtggcgacgaggccaaggcgaagcaggcgaagctgtcggtgaatgactttatcgtc
aaggctgcggcgttggctctgaagcaagtgccggcggctaactcggcgtggcacggcgag
tatattcgtgagtaccacacacaggacattagtatggccgtcgctacgccgaacggcctc
attacgccgatcattcggaactgcggcgcgattggtcttaccgagattggcaagcagagc
aaggagctcgccaagaaggcgcgcgacggcaagctgaagccggaagaataccagggcggc
acgttcacgatttcgaacatgggcatgatgggcacgtcccacttcacggcgatcatcaac
ccgccgcagagctgtatcttggcgatcggcgcgacagaggcacgccttgtgccggacgag
tcgacggacaagggcttcaggaccgtgcaggtgatgaaggcgacgatctcggcggaccac
cgcgttgtcgatggtgcgttggccgcccagtggatgcaggcattcaaggcagcgctcgag
aacccactctcgtttatgctgtga

DBGET integrated database retrieval system