KEGG   Malassezia globosa: MGL_0949Help
Entry
MGL_0949          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
mgl  Malassezia globosa
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:mgl04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MADFVKLSIFGTVFEITTRYENLQPVGMGAFGLVCSGHDKLTDTSVAIKKVMKPFSTPVL
AKRTYRELKLLKHIRHENIICLSDIFISPLEDLYFVTELLGTDLHRLLTSRPLEKQFVQY
FLYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARVQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDVWSAGCIFSEMLEGKPLFPGKDHVNQFSIITELLGTPPDEVIRT
ICSENTLRFVQSLPKRERIPFHQRFPHTDREALDLLDKMLVFDVNTRISAGDALAHPYLA
PYHNPADEPVAEEAFDWSFNDADLPIDTWKVMMYSEILDFHNIEEVPANEAQMPAQASGP
APALPQAQPMPSAYHSSMHP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttgtgaagctgtccatctttggtactgtgttcgagatcacaacacggtat
gagaatctgcagccagtgggcatgggcgcttttggcctcgtatgcagtggacacgacaaa
ctcactgacacgtccgtggccatcaagaaggtgatgaagcccttcagcacgcccgtgctg
gcgaagcgcacgtaccgagaattgaagctgctcaagcatattcgccatgaaaacatcatt
tgtctgagtgacatcttcatttcgcccctggaggacctgtactttgtgacagagctcctc
ggcactgacctgcatcgcttgctgaccagtcgtccccttgagaaacagtttgtacagtac
ttcttgtaccagatcctgcgtggcctcaagtatgtgcactctgccggtgtggttcaccgt
gacctgaagcccagcaacatcctaatcaacgagaactgtgacttgaagatctgcgacttt
ggtctggctcgtgtgcaggacccacaaatgactggttacgtgtcgacgcgctattaccga
gcgcctgagatcatgctcacgtggcaaaagtacgacgtggccgtggatgtctggagtgca
ggctgtattttctcagaaatgctcgaaggcaagccactgttccctggcaaagaccatgtc
aaccagttctcgatcatcaccgagctgctgggcacgccgcctgacgaggtcatccgcacc
atttgcagtgaaaataccctgcgtttcgtgcaatcgctgccgaagcgcgagcgtattccc
ttccaccagcgcttccctcacacagatcgggaggccctggatctcttggacaagatgctg
gtgtttgatgtgaacacccgcatctctgccggcgatgctctcgcgcacccgtatcttgcg
ccatatcacaatccagccgatgagcccgttgcggaggaagcgtttgactggagcttcaac
gatgccgacctccccatcgatacgtggaaagtgatgatgtattcggagatcctcgacttt
cacaatatcgaggaagttcccgcaaatgaagctcagatgcctgctcaggcaagtggccct
gcgcctgctctgccgcaagcccagccgatgccttcggcgtaccattcctccatgcatcct
tag

DBGET integrated database retrieval system