KEGG   Malassezia globosa: MGL_0959Help
Entry
MGL_0959          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mgl  Malassezia globosa
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mgl04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MRGISAWSALVTAVASVAMLGVQAEEAADSKVVSLTQDSFGKFVNDEPLSLVEFFAPWCG
HCQALAPQYEVAAKELESEKIKLAKVDCTQEEALCSEQGISSFPTLKVFRNGSASPYTGP
RKSEGIVNYMVKQSLPAVSDVTEINLEDFTSKDSFVVVAFAEESDKTTRDELRQFAEDHR
DMYVLGVSSSKDLAKAQGVKFPALVAFRKFDDPRAKYQGKGKSLSTDEIKSFVVVESLPL
MDEISAENFLNYAVTGTPLAYYFVDPASPKLDDDVKKLTKVAREFRGKVNMVWIDATKFS
SHGKALNLKGDSWPAFAIQDLKTGAKFPLNDLGKDVASSVRSFVSKFASGKLSPSLKSAP
VPKQTSPVIDVVADEFDKWVFDDSRDVLLELFAPWCGHCKKLAPTYEKLAELYAADAQAS
KQVRVAKLDGTENDIPPDADIDLAGFPTIVLKPAGKNSREFIVYDGDRTLESLVEFISTN
GKHHAKVAISKDSGSAKHDEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcatcagtgcatggagtgcattggtgacagctgttgcgtccgtcgctatgctt
ggagtacaggcggaagaagcagctgactcaaaggtggtgtctctgacgcaggactcgttc
ggcaagtttgtcaacgacgagccactgtcgctcgtagagttcttcgcgccgtggtgtggt
cactgccaggcccttgcgccacagtacgaagtggctgcgaaggagcttgagtcggagaag
atcaagctcgcaaaggtcgactgcacgcaagaggaggctctctgctcggagcagggcatc
tcaagcttccctactctcaaggtgttccgcaacggttccgcttcgccgtacacgggtcct
cggaagtcggagggtatcgtgaactacatggtgaaacagagcctgccagctgtttctgac
gttactgaaataaatctggaggactttacatcgaaggactcgttcgtcgtcgtggcgttc
gcggaagaaagcgacaagacgactcgggatgaactgcgtcagttcgctgaggaccaccgc
gacatgtacgtgttgggtgtgtcgagtagcaaggacctagccaaggcgcagggcgtcaag
ttcccagccctcgtggcgttccgcaagttcgatgatccccgagcgaagtaccagggtaag
ggcaagtcgctctcaacggacgagatcaagtcgtttgtggtggttgagtcgctcccattg
atggatgagatcagcgccgagaactttttgaactacgctgtgactggcacgccgcttgct
tactactttgtggacccggcgtcgccgaagctcgatgacgatgtcaagaagctcacaaag
gttgctcgtgagttccgtggtaaggtcaacatggtgtggattgatgctaccaagttcagc
tcgcatggcaaggcgctgaacttgaagggtgactcgtggccggcgttcgcaattcaggac
ttgaagactggcgccaagttcccgctgaacgacctcggcaaggacgtggctagctcggtg
cgctcgtttgtttcgaagtttgctagcggcaaactgtcgcccagcctgaagagtgcgcct
gtgcccaagcagacttcgcctgtgattgatgttgtcgcagacgaatttgacaagtgggtc
ttcgatgacagccgcgacgtcttgctcgagttgtttgctccatggtgtggtcactgcaag
aagctcgcacccacgtacgagaagctcgctgagctatatgctgcggatgctcaggcatcg
aagcaggtgcgtgtggccaagcttgacggcaccgagaatgatatcccaccggatgcggat
atcgacctggctggcttcccaaccattgtgctgaagccagcgggcaagaactcgcgtgag
ttcattgtgtatgatggtgaccgtacgctggagtcgcttgttgagttcattagcacgaac
ggcaagcaccatgccaaggttgctatctctaaggacagcggcagtgccaaacatgatgaa
ctgtag

DBGET integrated database retrieval system