KEGG   Malassezia globosa: MGL_0959Help
Entry
MGL_0959          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mgl  Malassezia globosa
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MGL_0959
Enzymes [BR:mgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MGL_0959
Exosome [BR:mgl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MGL_0959
  Exosomal proteins of colorectal cancer cells
   MGL_0959
  Exosomal proteins of bladder cancer cells
   MGL_0959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 501 aa AA seqDB search
MRGISAWSALVTAVASVAMLGVQAEEAADSKVVSLTQDSFGKFVNDEPLSLVEFFAPWCG
HCQALAPQYEVAAKELESEKIKLAKVDCTQEEALCSEQGISSFPTLKVFRNGSASPYTGP
RKSEGIVNYMVKQSLPAVSDVTEINLEDFTSKDSFVVVAFAEESDKTTRDELRQFAEDHR
DMYVLGVSSSKDLAKAQGVKFPALVAFRKFDDPRAKYQGKGKSLSTDEIKSFVVVESLPL
MDEISAENFLNYAVTGTPLAYYFVDPASPKLDDDVKKLTKVAREFRGKVNMVWIDATKFS
SHGKALNLKGDSWPAFAIQDLKTGAKFPLNDLGKDVASSVRSFVSKFASGKLSPSLKSAP
VPKQTSPVIDVVADEFDKWVFDDSRDVLLELFAPWCGHCKKLAPTYEKLAELYAADAQAS
KQVRVAKLDGTENDIPPDADIDLAGFPTIVLKPAGKNSREFIVYDGDRTLESLVEFISTN
GKHHAKVAISKDSGSAKHDEL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcatcagtgcatggagtgcattggtgacagctgttgcgtccgtcgctatgctt
ggagtacaggcggaagaagcagctgactcaaaggtggtgtctctgacgcaggactcgttc
ggcaagtttgtcaacgacgagccactgtcgctcgtagagttcttcgcgccgtggtgtggt
cactgccaggcccttgcgccacagtacgaagtggctgcgaaggagcttgagtcggagaag
atcaagctcgcaaaggtcgactgcacgcaagaggaggctctctgctcggagcagggcatc
tcaagcttccctactctcaaggtgttccgcaacggttccgcttcgccgtacacgggtcct
cggaagtcggagggtatcgtgaactacatggtgaaacagagcctgccagctgtttctgac
gttactgaaataaatctggaggactttacatcgaaggactcgttcgtcgtcgtggcgttc
gcggaagaaagcgacaagacgactcgggatgaactgcgtcagttcgctgaggaccaccgc
gacatgtacgtgttgggtgtgtcgagtagcaaggacctagccaaggcgcagggcgtcaag
ttcccagccctcgtggcgttccgcaagttcgatgatccccgagcgaagtaccagggtaag
ggcaagtcgctctcaacggacgagatcaagtcgtttgtggtggttgagtcgctcccattg
atggatgagatcagcgccgagaactttttgaactacgctgtgactggcacgccgcttgct
tactactttgtggacccggcgtcgccgaagctcgatgacgatgtcaagaagctcacaaag
gttgctcgtgagttccgtggtaaggtcaacatggtgtggattgatgctaccaagttcagc
tcgcatggcaaggcgctgaacttgaagggtgactcgtggccggcgttcgcaattcaggac
ttgaagactggcgccaagttcccgctgaacgacctcggcaaggacgtggctagctcggtg
cgctcgtttgtttcgaagtttgctagcggcaaactgtcgcccagcctgaagagtgcgcct
gtgcccaagcagacttcgcctgtgattgatgttgtcgcagacgaatttgacaagtgggtc
ttcgatgacagccgcgacgtcttgctcgagttgtttgctccatggtgtggtcactgcaag
aagctcgcacccacgtacgagaagctcgctgagctatatgctgcggatgctcaggcatcg
aagcaggtgcgtgtggccaagcttgacggcaccgagaatgatatcccaccggatgcggat
atcgacctggctggcttcccaaccattgtgctgaagccagcgggcaagaactcgcgtgag
ttcattgtgtatgatggtgaccgtacgctggagtcgcttgttgagttcattagcacgaac
ggcaagcaccatgccaaggttgctatctctaaggacagcggcagtgccaaacatgatgaa
ctgtag

DBGET integrated database retrieval system