KEGG   Malassezia globosa: MGL_1085Help
Entry
MGL_1085          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
mgl  Malassezia globosa
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MGL_1085
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MGL_1085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 212 aa AA seqDB search
MHGLGDTAQGWLDVARALGRNQALQHIRFVLPTAPVQPVTINMGMSMTSWFDLYSLTDLD
QGEDESGMRKSAAAIWDLVAQETNGSAPGLNGHKVPMNRIVLAGFSQGGVMAQLMGLTAQ
ERPAGIAALSTWLPLHQKMASMHSKHTFPFFQAQGTVDPLVDYKYARRSFDYVQSSLGFG
KLAEGHEYRMPHSACPAEITDLGSWLERVVPV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcatggtttgggcgatactgcacaaggttggctggatgtggcccgggcccttggacgc
aaccaggctctgcagcatatccggttcgtgctaccgacagctccagtccagcccgtcact
atcaatatgggcatgtccatgacatcttggttcgatctctattcactcacagatttagac
caaggtgaagatgaatcgggtatgagaaaaagcgctgcagccatctgggacttggttgct
caggagacgaatggtagtgcacctggtctcaatgggcataaggtgccgatgaatcgtatc
gtgctggctggattcagtcaaggcggcgttatggctcagctgatgggcttaacggcgcaa
gagcgccccgcaggcattgccgcgttgtcgacatggcttccattgcaccaaaaaatggct
tcaatgcacagtaagcacacatttcctttcttccaggcacagggcacggtggatccgctt
gtggactacaagtatgcacgccgctcgtttgattatgtgcaatcatccctgggcttcgga
aaactggctgaggggcacgaatatcgtatgccacactcggcgtgtcctgccgaaattacc
gatttgggcagttggcttgaacgagtcgtgcctgtctga

DBGET integrated database retrieval system