KEGG   Malassezia globosa: MGL_1085Help
Entry
MGL_1085          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
mgl  Malassezia globosa
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mgl00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 212 aa AA seqDB search
MHGLGDTAQGWLDVARALGRNQALQHIRFVLPTAPVQPVTINMGMSMTSWFDLYSLTDLD
QGEDESGMRKSAAAIWDLVAQETNGSAPGLNGHKVPMNRIVLAGFSQGGVMAQLMGLTAQ
ERPAGIAALSTWLPLHQKMASMHSKHTFPFFQAQGTVDPLVDYKYARRSFDYVQSSLGFG
KLAEGHEYRMPHSACPAEITDLGSWLERVVPV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcatggtttgggcgatactgcacaaggttggctggatgtggcccgggcccttggacgc
aaccaggctctgcagcatatccggttcgtgctaccgacagctccagtccagcccgtcact
atcaatatgggcatgtccatgacatcttggttcgatctctattcactcacagatttagac
caaggtgaagatgaatcgggtatgagaaaaagcgctgcagccatctgggacttggttgct
caggagacgaatggtagtgcacctggtctcaatgggcataaggtgccgatgaatcgtatc
gtgctggctggattcagtcaaggcggcgttatggctcagctgatgggcttaacggcgcaa
gagcgccccgcaggcattgccgcgttgtcgacatggcttccattgcaccaaaaaatggct
tcaatgcacagtaagcacacatttcctttcttccaggcacagggcacggtggatccgctt
gtggactacaagtatgcacgccgctcgtttgattatgtgcaatcatccctgggcttcgga
aaactggctgaggggcacgaatatcgtatgccacactcggcgtgtcctgccgaaattacc
gatttgggcagttggcttgaacgagtcgtgcctgtctga

DBGET integrated database retrieval system