KEGG   Malassezia globosa: MGL_1096Help
Entry
MGL_1096          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mgl  Malassezia globosa
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:mgl03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:mgl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 340 aa AA seqDB search
MSAHMKFNMTDNSPAEVDVDNIIDRLLEVRGSRPGKPVQLEEYEIKYLCLTARDIFINQP
ILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAY
KIKYPENFFILRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIF
TMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDISGWSENDRGVSFTFGPD
VVSRFLAKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLL
CSFQILKPAEKKQKYAYGGINMGRPVTPPRKQKKKGDRTV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcatatgaagttcaatatgacagacaactcaccagccgaagtcgatgtggat
aatattattgaccgtcttctggaagtgcgtggatcacgtccaggaaaacccgtacaacta
gaggaatatgagatcaagtacctctgtctgacagcgcgtgatatctttatcaatcagccg
attcttcttgagcttgaagcgccgatcaaaatttgtggcgatatacatggtcagtactac
gacctgctccggttgtttgagtatggcggatttcctcctgaggccaactacctattcctt
ggcgactacgtggatcgaggcaagcaaagtctagaaaccatatgcttgttgctagcttac
aagatcaagtaccctgaaaacttctttatactccgaggaaaccacgagtgcgctagtatc
aatcgcatttatggattctatgatgagtgcaaacgtcgcttcaatatcaagctatggaag
acattcacagattgcttcaactgtcttccgattgcggcgattattgacgagaagatcttc
acaatgcatggtggtttgtcccccgatctccaaagcatggaacagattcgacgtgtaatg
cgcccgacggatgtgccggacacgggtctgctgtgtgacctgttgtggtcggaccccgat
aaggacatctcaggatggtctgaaaatgatcgaggagtatcgttcacattcggacctgac
gttgtgtctcgcttccttgcaaaacacgatatggacctgatctgccgtgcacatcaggtt
gtggaagatgggtatgagttctttgcgaagcgccagcttgtcactctgttctcggcaccc
aactactgtggtgaatttgacaacgcaggtgccatgatgagtgtggatgaaacgttgctt
tgttcattccaaatcctgaagccagcagagaagaagcagaaatatgcttatggaggaatc
aacatgggccgacccgtgacaccgcctcgcaagcagaaaaagaaaggcgatcgtactgtc
taa

DBGET integrated database retrieval system