KEGG   Malassezia globosa: MGL_1201Help
Entry
MGL_1201          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mgl  Malassezia globosa
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgl00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MTIIRGFSDEKDPIAAVLNKHGLGWPAKSTLDRLNFSPEEATANEDRLAGAVRTILECLG
EDPDRSGLQDTPKRYARALLWMTKGYEERLCDVISNAIFDENHDEMVIVRDIDVFSLCEH
HLVPFKGKIHIGYIPNRMVIGLSKLARIAETFARRLSVQERLTRQVALALNEALKPRGVA
VVMECEHMCMAMRGVQKPGSNTVTSCMLGVFRDRAKTREEFLSLIRHN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatacgtggattttctgacgagaaggaccctattgcagcggtgctaaacaag
catgggctaggatggccagcaaagtcgacacttgatcgcctgaacttttctccggaggag
gcaactgcaaatgaagaccggctagctggtgctgtgcgtacgattctcgaatgtctagga
gaggacccagatcgctccgggcttcaagataccccgaaaagatatgcacgggcgctcctg
tggatgacaaaggggtacgaagaacggttgtgtgatgtaatatccaacgctatattcgat
gaaaatcatgatgaaatggtcattgtgcgtgatattgatgtgtttagtctgtgtgagcat
catcttgtaccatttaaaggcaagattcacatcggctatattccgaatcgcatggttatt
ggtctgtcgaaattggcacgcattgcagagacttttgctcgccgcttgtctgttcaggag
cgactcacacgccaagtcgctcttgctctcaacgaggcactcaagcccagaggcgtggct
gtcgtcatggaatgcgaacacatgtgcatggcgatgcgtggtgtgcaaaagcctggatca
aatacggtgacgagctgcatgttgggagtgttccgcgatcgcgccaagacgcgtgaagaa
ttccttagcctgattaggcacaactaa

DBGET integrated database retrieval system