KEGG   Malassezia globosa: MGL_1201Help
Entry
MGL_1201          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mgl  Malassezia globosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGL_1201
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MGL_1201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 228 aa AA seqDB search
MTIIRGFSDEKDPIAAVLNKHGLGWPAKSTLDRLNFSPEEATANEDRLAGAVRTILECLG
EDPDRSGLQDTPKRYARALLWMTKGYEERLCDVISNAIFDENHDEMVIVRDIDVFSLCEH
HLVPFKGKIHIGYIPNRMVIGLSKLARIAETFARRLSVQERLTRQVALALNEALKPRGVA
VVMECEHMCMAMRGVQKPGSNTVTSCMLGVFRDRAKTREEFLSLIRHN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatacgtggattttctgacgagaaggaccctattgcagcggtgctaaacaag
catgggctaggatggccagcaaagtcgacacttgatcgcctgaacttttctccggaggag
gcaactgcaaatgaagaccggctagctggtgctgtgcgtacgattctcgaatgtctagga
gaggacccagatcgctccgggcttcaagataccccgaaaagatatgcacgggcgctcctg
tggatgacaaaggggtacgaagaacggttgtgtgatgtaatatccaacgctatattcgat
gaaaatcatgatgaaatggtcattgtgcgtgatattgatgtgtttagtctgtgtgagcat
catcttgtaccatttaaaggcaagattcacatcggctatattccgaatcgcatggttatt
ggtctgtcgaaattggcacgcattgcagagacttttgctcgccgcttgtctgttcaggag
cgactcacacgccaagtcgctcttgctctcaacgaggcactcaagcccagaggcgtggct
gtcgtcatggaatgcgaacacatgtgcatggcgatgcgtggtgtgcaaaagcctggatca
aatacggtgacgagctgcatgttgggagtgttccgcgatcgcgccaagacgcgtgaagaa
ttccttagcctgattaggcacaactaa

DBGET integrated database retrieval system