KEGG   Malassezia globosa: MGL_1217Help
Entry
MGL_1217          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MGL_1217
Peptidases [BR:mgl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGL_1217
Transcription machinery [BR:mgl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MGL_1217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MDSSSAELSQSGQHDAHEMFISALNGIHNSLTAHALERKKLPACPWEGEHMLEHLHEHAE
QPSGARVPNRAVDHVAQCPCVIHRTFCGRLQSSVTCLACSKSTHTREPFLDLSLQVYPME
TNEPDDSKKKRTVAADSKKREKGTPVAETSAQSLYASLLRYCAKEQLPEASYRCSHCLQS
SKATKQLHLYQLPPVLCIQLKRYEHGIGTSKVDARVHFPLVLDVRECCTGAQETDESMDP
FAYAYDLFTVVVHQSTLTSGHYTNFSKWRDAWYRYDDDKVTRASIAQVLEARAYQLFYLR
RRLRNQPSHGVHTLSKSST
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggattcctcttccgcagaactctctcagtctggacaacatgatgcacatgaaatgttc
atcagtgcgctcaatgggatccataattcactcacagcacacgcgcttgaacggaaaaag
ctgccggcttgcccctgggaaggcgagcacatgctcgagcatctgcacgaacatgccgag
cagcccagtggtgcacgtgtgccgaaccgagccgtggaccatgtagcacaatgtccctgt
gtcattcatcgcacgttttgtgggcgcctgcagagcagtgtgacgtgcctggcttgcagc
aagtctacacatacgcgagaaccgtttctcgatttgagtcttcaggtatacccgatggag
acaaatgagccagatgactcgaagaaaaagcgcactgtggccgccgattcgaagaagcgc
gaaaaaggcaccccagtcgcagagactagcgctcaaagcttgtatgcgagtttactgcgc
tactgtgcgaaggagcaactgcctgaggcgtcgtatcgctgcagccattgtcttcaaagt
tcgaaagcgacaaaacagctgcatttgtatcagctgccaccggttttgtgtatccaacta
aaacgttatgagcatggcatcggcacatctaaagtcgacgcacgcgtgcactttcctctt
gtgctggatgtgcgtgaatgctgcacaggagcccaagagaccgatgaatctatggatcct
tttgcgtatgcttacgacctttttactgtcgttgtgcaccaaagcacgctgacttctggt
cattatacaaacttttcaaaatggcgcgacgcatggtaccgctacgacgatgataaggtg
acgcgggcatcaatagcgcaagtgctagaggcgcgagcgtatcaactcttttatcttcgt
cgtcgcctgcgcaatcagccaagccacggtgtacatactctttccaagtcaagtacatag

DBGET integrated database retrieval system