KEGG   Malassezia globosa: MGL_1296Help
Entry
MGL_1296          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mgl  Malassezia globosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MGL_1296
Enzymes [BR:mgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MGL_1296
Exosome [BR:mgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGL_1296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 162 aa AA seqDB search
MDNRIRAIREGLLRENLANQTTIMSYSAKFASSMYGPFREAVASAPSFGDRRCYQLPPGA
RGLARRAIVRDVQEGADIVMVKPAMPYLDMLSDARELAPDHPLACYQVSGEYAMLHAAAN
AKVGDLRAIVEESMTSMLRAGASLILTYFTPELLQWIDEPRS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccgtattcgggctattcgcgaaggcttacttcgggagaatcttgcgaatcag
acgaccattatgtcctacagcgccaaattcgcttcaagcatgtatggacctttccgtgag
gccgtggcatcggcgccctcctttggtgatcgtcgctgctatcaattgccgcccggtgca
cgtggattggcacgaagggctatcgtgcgagatgtgcaagaaggagctgatattgtgatg
gtcaaacctgctatgccgtacctggacatgctatcagatgctcgcgaacttgcacctgac
catcctctcgcttgttaccaagttagcggagagtacgcgatgttgcatgcggctgcgaac
gccaaggttggtgatcttcgagcgattgtagaggaaagcatgacctcgatgcttcgtgca
ggtgcatcgttgattttgacgtattttactcctgaacttctccagtggatcgatgaacct
agatcataa

DBGET integrated database retrieval system