KEGG   Malassezia globosa: MGL_1298Help
Entry
MGL_1298          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGL_1298
Translation factors [BR:mgl03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MGL_1298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 298 aa AA seqDB search
MASESSVTSTANKRPMKTGETSSTTNSLAADSEAASKSTLATVQDEKQVPTSLNTEKDGD
EIRTVFQDPVKFNVKHPLYNVWTLWFDNPGHKGSGSAKERRETWGANLHKVVDLQSVEEF
WGLYNNIVPPSLLPQSANYYLFKQGIQPAWEDPANGGGGKWSLQLPREKHRNQIDKLWLY
TMLSAIGEMLETPAPDSKLPESRDDEIVTGVVLQARANYYRISVWTRYSDEWDTELPEGS
EASESLMRGRRLIGLGRFFKTEVLGYPLDAKVGGGFSSEVEFQSHKDSEKKRGKRSVT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagaatcatctgtcacttcaacagctaataagaggcccatgaaaacgggagag
actagctcgacaaccaacagtcttgcagctgattcagaagccgcatctaaatcgacgctg
gcaactgtgcaagatgagaaacaggtaccgacgtctttgaacactgaaaaagatggggat
gaaatacgcactgtgtttcaggatcctgtcaaatttaatgtgaaacatccattatacaac
gtgtggactttgtggtttgacaacccaggtcacaaaggctctggaagcgcgaaggagcgc
cgcgaaacttggggtgctaaccttcacaaggtcgtggacttgcaaagtgtcgaagaattc
tggggtctttacaacaacatcgtgcctccatcactgttgccacagagtgctaattactat
ctcttcaagcaaggtatccagcctgcatgggaggatcctgccaacggtggtggtggtaaa
tggagtctccaacttccacgcgaaaagcaccgtaaccaaattgataaactctggctctat
accatgctatccgccatcggtgagatgcttgaaacgcctgcacctgattcaaaactgcct
gaatcgcgtgacgacgagattgtgacaggtgtggtccttcaggctcgtgcaaattattac
cgtatttctgtttggacgaggtattcggacgagtgggatactgaacttccagaaggttca
gaagcatctgagtcactcatgaggggccggcgacttattgggctgggtcgcttcttcaag
accgaggttttgggataccctctcgatgctaaagtaggcggcggtttttcgtctgaggtc
gaattccaaagccacaaggacagcgagaaaaagcgcggcaagcgaagtgtgacataa

DBGET integrated database retrieval system