KEGG   Malassezia globosa: MGL_1397Help
Entry
MGL_1397          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mgl  Malassezia globosa
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mgl03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mgl03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MVGSEQAASPRNTVLFLLQRAGLMQRDHQTNDKLNITSLGFQFLLQDVNSQLWALLLHYL
SMADERNMDLVEVLAFFFTVGGLELGRAYESRGFSQTQLQTLEELSDYGLVYRPSKSAKY
FFPTRLASTLTSTASPLLSRLNDQEEQGYLILETNYRVYAYTANLLRIAILNLFVTLKSR
LPNLVIGQLTRHSVKSALNKGITADQIITYLTHHAHPQMYKNVSVKVTHSA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagtgaacaggcagcgtctcctcggaatacagtgctttttctcctgcagcga
gctggactcatgcagcgagatcaccagactaatgacaaactgaacattacgtcattaggc
ttccagttccttctacaagacgttaattcacagctttgggcacttttgctgcactaccta
agtatggcagatgagcgcaatatggatcttgttgaggtgcttgcatttttcttcacagtg
ggtggtctcgagctaggtcgtgcgtatgagtcgcgaggcttttcacagacacaactccag
acacttgaagaattgagtgattatggtcttgtatatcgaccaagcaaatctgcaaagtat
ttctttcctacgagacttgcatcaacactcacgtcaacggcatcgcctctcttatctaga
ctaaatgaccaggaggagcaagggtatcttattctcgagacgaactatcgggtctacgca
tacacagcaaaccttctgcgcattgcgattttaaatttgtttgtgacgctaaagagccgc
ctgcctaacctggtgattggacagcttaccagacacagtgtcaaatcagcgctgaacaaa
ggcattacagcggatcaaatcatcacatacttgacccaccacgctcaccctcagatgtat
aaaaacgtaagtgtaaaggtgactcactcggcgtag

DBGET integrated database retrieval system