KEGG   Malassezia globosa: MGL_1397Help
Entry
MGL_1397          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mgl  Malassezia globosa
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MGL_1397
  Replication and repair
   03420 Nucleotide excision repair
    MGL_1397
Transcription machinery [BR:mgl03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MGL_1397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MVGSEQAASPRNTVLFLLQRAGLMQRDHQTNDKLNITSLGFQFLLQDVNSQLWALLLHYL
SMADERNMDLVEVLAFFFTVGGLELGRAYESRGFSQTQLQTLEELSDYGLVYRPSKSAKY
FFPTRLASTLTSTASPLLSRLNDQEEQGYLILETNYRVYAYTANLLRIAILNLFVTLKSR
LPNLVIGQLTRHSVKSALNKGITADQIITYLTHHAHPQMYKNVSVKVTHSA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagtgaacaggcagcgtctcctcggaatacagtgctttttctcctgcagcga
gctggactcatgcagcgagatcaccagactaatgacaaactgaacattacgtcattaggc
ttccagttccttctacaagacgttaattcacagctttgggcacttttgctgcactaccta
agtatggcagatgagcgcaatatggatcttgttgaggtgcttgcatttttcttcacagtg
ggtggtctcgagctaggtcgtgcgtatgagtcgcgaggcttttcacagacacaactccag
acacttgaagaattgagtgattatggtcttgtatatcgaccaagcaaatctgcaaagtat
ttctttcctacgagacttgcatcaacactcacgtcaacggcatcgcctctcttatctaga
ctaaatgaccaggaggagcaagggtatcttattctcgagacgaactatcgggtctacgca
tacacagcaaaccttctgcgcattgcgattttaaatttgtttgtgacgctaaagagccgc
ctgcctaacctggtgattggacagcttaccagacacagtgtcaaatcagcgctgaacaaa
ggcattacagcggatcaaatcatcacatacttgacccaccacgctcaccctcagatgtat
aaaaacgtaagtgtaaaggtgactcactcggcgtag

DBGET integrated database retrieval system