KEGG   Malassezia globosa: MGL_1417Help
Entry
MGL_1417          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mgl  Malassezia globosa
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MGL_1417
  Lipid metabolism
   00062 Fatty acid elongation
    MGL_1417
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     MGL_1417
Lipid biosynthesis proteins [BR:mgl01004]
 Fatty acid synthase
  Component type
   MGL_1417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 400 aa AA seqDB search
MGLHLQVCRWPLRLPQQYRAPLPMVIWHGLGDSAYSEWLIKLKEDLEDMYPGIYVHLISL
DSTPSGDKSATFMGNVNDQIEQVQRQLAKVPELQAGFDAIGFSQGGQFLRGYVERFNTPR
VRNLVTFGAQHMGITQLPGCAEGDRLCNLVMRSFEGRMYSDFAQTRLVVAQYFRDTRLAS
QYQQYEQRNRFLYDINNEGPSKQELYKTNIKQLEKFVMVRFSEEETVVPSESAWFSAYED
PEHRRDDAVNMTIPLRTSRLYKEDWIGLRHLDARGGLAFHTCEGQHMQLSPPCKSLVFHT
YVGHPRFDEASMNILEGFMNISLYALICIGLMICMRRLYRPLGDATHVTAPSSLGALEPR
AKHEAAFPNLVGTQRFRREPIYGNANTPHDMRQVSFVARA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgcacctccaagtatgtcggtggcccctgcgactacctcagcaataccgagcg
ccccttcctatggtgatttggcatggcttgggcgactcagcatactcagaatggctcata
aagctgaaagaagatcttgaagacatgtatccaggtatctatgtccatctgatttcactg
gattcgacaccgtctggcgataaatcagcgacgttcatggggaacgtgaatgaccaaatt
gagcaagttcagcgccagctagcgaaggtgcctgaacttcaggcaggttttgatgcgata
ggcttctcgcaaggtggccaatttctccgcggatacgtggaacgcttcaacacgccgcgt
gtgcgcaaccttgtcacgtttggtgcgcagcacatgggcatcactcagctgccaggttgt
gcagaaggagatcggttgtgcaatctggtcatgcgaagcttcgagggcaggatgtactcg
gattttgcacaaacgcgtcttgtggtagcccaatacttccgcgacacgcggctggcgtcc
cagtaccagcagtacgaacaaaggaaccggttcctgtatgacatcaataatgaaggacca
agcaaacaggagctatacaagacaaacataaaacagctcgaaaagtttgtcatggttcgg
ttcagcgaagaagagacagtggtgccgtcagagtcagcatggttttcggcgtacgaggac
ccagagcaccgccgcgacgatgcggtaaatatgacaataccgttgcggacaagccggctg
tataaagaggactggattgggctgcggcatttggatgcacgaggcggccttgcatttcat
acgtgtgagggccaacacatgcaactttcgccaccatgcaagtcgcttgtatttcacacc
tacgttggccatccacgttttgacgaggcgagcatgaacatactcgagggctttatgaac
atttcgctctacgcactgatttgcattggactgatgatttgcatgcggcgcctctatcgc
ccactaggtgatgctacgcacgttactgcgccttcttcattgggggcgttggagccacgt
gccaagcacgaagcggctttcccaaacctagtcggaacgcagcgattccgaagagaacca
atatatggtaatgccaatacaccgcacgatatgcgccaagtgagtttcgtagcgagagcg
taa

DBGET integrated database retrieval system