KEGG   Malassezia globosa: MGL_1437Help
Entry
MGL_1437          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mgl  Malassezia globosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 574 aa AA seqDB search
MAQTVPGTRLGKVHKPGARAQHVLEDAIKPGAHLRSLLDEPVRFVGSSRDELKASLSLDA
ARASNMEIVNEPVDAQPSRSSKRTNDNADASASTAGTSLRTVSAPTQPLYTPRIIPRFPR
AHMRAAGLHNRGNTCYMNSVMQSLLHTPPLATALLTQSAPTLLGRYGVPRTQKQAVKAAN
SFNALTEMKDFFAHAYSGASAVSPTAFVSNLRKFARPLRPGRQEDAHEYLRLLLEALQQA
CTCFAGKDIKPNDPILSTTLIQRIFGGRLRSRVTCYSCRHNSDTYDPMLDLSLDVRKGIH
TVKQALDAFTAAEALADKYQCDHCQRRVEATKRFSIDQAPMVLTVHLKRFGIFGNKINKP
ISYSDRLHLGRYMSERDKGLGADVEDEPDLGTLGAAQQYRLFAIVHHYGSGPNVGHYVAS
VRSADGQWLRMDDSFVSKLPQCPLDDPSAYLLFYLREPITMEESSKPTTMTSPKKRKAAS
IKRDDDGHDHGPGVSADIVMGEPVSRAEYARLRESLDAGTEDGVDNDGSTESPSRDSGGI
DSGSDDDVVGAQPVMSKKEIRRRKRRKASSAHRK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacagtgccaggtacacggctaggcaaggtgcataagccaggcgcgcgtgca
cagcatgtgctagaggatgccatcaagcctggtgcgcatcttcgttctttgcttgatgag
ccagtgcggttcgtcggcagttcacgcgacgagctcaaggcgtcattgagcttggatgcc
gcgcgtgcgtcgaacatggagattgtgaatgagcctgtcgacgctcagccaagtcgttct
tccaagcgcaccaacgacaacgcggatgcttctgcttctactgcaggcacatctcttcga
acggtcagcgcacctacccagcccctgtacacaccacgcatcataccccgttttcctcgt
gcacacatgcgtgcggccggtctgcacaatcgtgggaatacgtgctacatgaacagtgtg
atgcagtctctcctgcacacgccgccacttgccacagccttgctcacacagagtgcacct
acgttgctaggtcgctatggcgtcccgcgtacacaaaaacaggctgtaaaggcggccaac
tccttcaatgcgctcacggaaatgaaggacttttttgcgcatgcatacagcggagcatct
gccgtgtcaccaacggcattcgtctcaaacctacgcaagtttgcacgaccattacggcct
gggcgccaagaagatgcacacgagtatttacgcttacttctagaggcgttgcagcaggca
tgcacatgctttgctggaaaggacatcaagccaaacgaccccattctcagcacgacactg
atccagcgtatctttggcggtcgtctgcgtagtcgcgtaacgtgctacagctgtcggcac
aattcggatacatatgacccaatgctcgacctgagcctagacgtgcggaaaggcatccac
actgtgaagcaagcgctcgacgcatttacggcggctgaggctctggccgacaagtaccaa
tgtgatcattgccagcggcgcgtcgaggcaacaaaacgtttttctatcgaccaggcgcct
atggtgctcacggtgcatctgaagcggttcggcatctttggcaataagatcaacaagccc
atcagttactcggaccgcttgcatttaggccggtacatgagcgagcgagataagggactc
ggcgcagatgtcgaagacgagccagacctcggcacgctgggcgccgctcagcaatatcga
ctctttgcgatagtgcaccactacggcagcgggccgaatgtcggtcattatgtcgcaagc
gtgcgttctgctgatggccagtggcttcgcatggatgactcgtttgtgtcaaagctcccg
cagtgcccactcgacgacccgtcagcctacctccttttctatctgcgtgagcccatcacg
atggaagagtccagcaagccgacaacgatgacatcgccgaaaaagcgcaaggccgcgtcg
atcaagcgtgacgacgatggccacgaccatggccctggcgtgagtgctgatatagtgatg
ggcgagcctgtgtctcgggctgaatatgcaagactgcgtgagtcattagacgctgggaca
gaggacggcgttgataatgacggtagcaccgagagtccgtcacgcgatagtggtggtatc
gattcgggctccgacgatgatgttgtcggtgcgcagcccgtgatgagcaagaaagagatc
cgtcggcgcaagcgacgaaaagcgtcctctgcacataggaaatga

DBGET integrated database retrieval system