KEGG   Malassezia globosa: MGL_1459Help
Entry
MGL_1459          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgl  Malassezia globosa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MGL_1459
   00052 Galactose metabolism
    MGL_1459
   00500 Starch and sucrose metabolism
    MGL_1459
   00520 Amino sugar and nucleotide sugar metabolism
    MGL_1459
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MGL_1459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 459 aa AA seqDB search
MVEKLSSSLDDKSLRTARQRVGSHIDFKSATSAVASKAMRNELNALIEGIEDPAARHAFE
AEMASFYHLFNRFLAEKAKGERLDWDKIQPPAPEQVTSYASLPQATDPSVLDKLAVLKLN
GGLGTTMGCTGPKSVIEVREGMTFLDMSVRQIEHLNGTYNVNVPFILMNSFNTDDDTARV
IQKYANHNVEIMTFNQSRYPRINRDSLLPCPRSATSNKNLWYPPGHGDLFDAMNNSGLLD
SLLAMGKEYVFVSNVDNLGAVVDLNIYQHMIETQAEFISEVTDKTKADVKGGTLIDYEGT
VRLLEIAQSLESGEPVIQLETAVGAAIKHFRGAKGVNVPRSRFLPVKSCSDLLLITSDLY
GLEHGKLVMNPQRQFNQTPVVKLGDNFKKVANYQKRFKSIPKMMELDHLTVMGDVSFGRN
VVLKGTVIIVANEGNRIEIPDGAVLENKLVTGNLAIIDH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaagctctcctcgtctctggatgacaagtcgctccgcactgctcgtcaacgt
gttggatcacacattgacttcaagtcagctacctcagccgtggcgagcaaggctatgcgg
aatgaactgaatgcactgatcgaaggtattgaagatccagctgctaggcatgcatttgaa
gcagaaatggcttctttctaccaccttttcaatcgcttcctcgctgagaaagcgaagggc
gaaagacttgactgggacaagatccagcctcctgcaccagaacaagtgacgtcttacgcg
tcgttgccgcaagcgacggacccatccgtcctggacaagctggctgtgctgaagcttaat
ggcggtcttggcacgacaatgggctgcacgggcccaaagagtgtgattgaagtacgtgag
ggtatgactttcctcgatatgtccgtgcgtcagattgagcacttgaatggcacgtataat
gtgaacgtaccattcatcctgatgaactcgttcaacacggacgacgatacggcgcgtgtc
attcagaagtacgcgaaccacaacgtggagattatgacgttcaaccaatcgcgctacccg
cgtatcaaccgggacagtcttcttccctgcccccgcagcgcgacgtccaacaagaatctg
tggtacccaccaggccacggtgacctcttcgatgccatgaacaactccggtctgcttgac
agccttcttgccatgggcaaggagtatgtgtttgtctcgaacgttgacaacctgggagct
gtggttgacctcaacatctaccagcacatgattgagacacaggctgagttcatttcagag
gtgaccgacaagacgaaggcagacgtcaaaggtggcacgctgattgactacgagggcacc
gtccgtctgctcgaaattgcgcaatctcttgagagcggtgagccagtcatccagcttgaa
acggctgtcggtgcggctatcaagcatttccgtggcgcgaagggtgtgaatgtgccgcgt
tcgcgcttcctgcctgtcaagagctgctcggacctgctccttattacgagtgacttgtac
ggtcttgagcacggcaagctagtcatgaacccgcagcgccagttcaaccaaacgcctgta
gttaagctgggcgataacttcaagaaggtcgcgaactaccagaagcgcttcaagagcatt
ccaaaaatgatggagcttgaccacctaacagtcatgggcgatgtgtcgttcggccgcaat
gtggtgcttaagggcactgtgattatcgttgccaatgaaggcaaccggattgaaattcct
gatggtgccgttctggagaacaagcttgtgactggcaacctggctatcattgaccactag

  All links  
No link information was found.   
DBGET integrated database retrieval system