KEGG   Malassezia globosa: MGL_1481Help
Entry
MGL_1481          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mgl  Malassezia globosa
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MGL_1481
   00240 Pyrimidine metabolism
    MGL_1481
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MGL_1481
   03410 Base excision repair
    MGL_1481
   03420 Nucleotide excision repair
    MGL_1481
   03430 Mismatch repair
    MGL_1481
   03440 Homologous recombination
    MGL_1481
DNA repair and recombination proteins [BR:mgl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      MGL_1481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 168 aa AA seqDB search
MAPSRTSGAGNALGLTSTKSRAASVRASGKRAAKLSAAAQAVEAVHAAEHAAESAQPKYT
REQLKKAEGLPSIHIDDPRFDGIWQRTRKTMGMQPIHSEDLSRIEHILRVFDLDPAFGPC
MGLTRLERWERAKDIGNDPPNEVREILLSREGVLDWSSSILDQDAGLT
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcacctagcaggacaagcggagccggtaatgcactgggtcttacaagtaccaagtcg
cgcgctgcgtctgtgcgtgcgagtggaaagagagcagcgaaacttagcgctgctgcacaa
gctgtggaagcggtgcatgcagctgaacatgcagccgaatctgcgcagccgaaatatacg
agagaacaactaaaaaaggctgagggccttccatctattcacatagatgacccacgcttt
gatggcatttggcaaaggacacgcaagacgatggggatgcagcccattcattctgaagat
ctaagccgcattgagcacattttgcgcgtatttgacttggatccagcatttggtccttgt
atggggctcacacgtctggaacgctgggaacgtgcaaaagatatcggcaacgacccgccc
aatgaagtgcgtgagatccttctgtcgcgcgagggagtgctggactggtctagcagtatt
cttgaccaagatgctgggttgacttga

DBGET integrated database retrieval system