KEGG   Malassezia globosa: MGL_1551Help
Entry
MGL_1551          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MGL_1551
Chromosome [BR:mgl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    MGL_1551
   HAT complexes
    TIP60 complex
     MGL_1551
    NuA4 complex
     MGL_1551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 235 aa AA seqDB search
MKRHRQKCTLLHPPGNEIYRCEDISFFEIDGRRQKTWCRNLCLLSKCFLDHKTLYYDVDP
FLYYVMCQRDNTGCHMIGYFSKEKESAEGYNVACILTLPQHQRSGFGRLLIEFSYELSKR
ENKLGSPEKPLSDLGLLGYRAYWSETIVELLLHTNEEVSIDDIANKTSIVHADVLQTCQA
LNMLKQYQGKHYLVLSDAIIEKHERQMKKKRRRIHPEHLHWKPPVFTRDQLRFGW
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacaccggcaaaagtgtactctgcttcatccacccggcaacgagatctaccgt
tgtgaagatatcagctttttcgaaatcgacggccgtcggcaaaagacttggtgcaggaac
ctgtgcttactgagcaagtgcttcctcgaccacaagactttgtactatgacgtcgacccc
tttctttactacgtgatgtgccaacgcgacaacacaggctgtcatatgatcggctacttc
tccaaggaaaaggagagtgccgaaggctacaatgtcgcttgtattcttacacttccacag
catcagcgcagtggattcgggcgcttgctgattgagttttcgtacgagctttccaagcgc
gaaaacaagcttggtagtccggaaaagcccttatccgacttgggcttacttgggtatcgt
gcctattggtctgagacgatcgtcgagcttcttctccatacgaacgaggaagtcagtatt
gacgacattgccaacaagacatcgatcgtgcatgcagatgtcctccagacttgccaagcc
cttaacatgctcaagcaataccagggcaaacactatctggtcctgtcggatgccattata
gaaaaacacgaacgccaaatgaaaaagaagcgccggcgcatccatcctgaacacttgcat
tggaaaccacccgtctttactcgagaccaactccgcttcggctggtga

DBGET integrated database retrieval system