KEGG   Malassezia globosa: MGL_1598Help
Entry
MGL_1598          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MGL_1598
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   MGL_1598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 967 aa AA seqDB search
MPVSAHNSADAALENGTWTDAQGDDYVHGYGSAETAVLQRPVVDDSGERSDSSASAPVAS
ETLAPDLSMSSHDTSSHYARKMREQGVETPSTTSPVSERSTRSSPVVSPSPSQDSSESSS
IETALVSEEGPARDATSSTTTAVSIGTSLSQAPAARQTQMPKRPGQPQFEGFWQVQSLED
LRPMHDSSQLCAKQRRADPIGGSVSPLKALTSYLHHTYHLVNPAFVYELAFNPRRVLTKP
SKPVYNDGYDNEESDYILYVNDYLGNEEGHRYLILDVLGQGTFGQVVKCQNMSNHEIVAV
KVIKNKPAYFNQSMMEVTILETLNQHWDPDDQHNILRLRDTFIHHKHLCLVFELLSSNLY
ELIKQNSFRGLSTSLVRVFISQLLDALVVLKEARLIHCDLKPENILLRTLQAPSIKLVDF
GSACHEEQTVYTYIQSRFYRSPEVLLGLPYTSSIDMWSLGCIAAELFLGLPIFPGTSEYN
QLSRITSMLGLPPAFMLERGRQTHEFFNVHTDPFGRAIFQLKSMEQFSREHRVQEQPSKQ
YFPGTTLPEVIRLTPISRRSGRSADTDKEMANRAAFTDFIAGLLNMNPLERWTPQQAKQH
PFITGEPYTQPWQPSDASAIAATAAAAAAAAAAAPPAPETVHAHALTHAPAHPPVPGTTG
PATGPPMPTTAAAAAAGAAVAARASSVSATATQGAPSNLPSEASAAIHSYAEPPPPEDPY
AVLQPFNRSNAPRAYVSPSSAAPANHTAVQSPGVEAQHMYDMSAGAASSAYHPTHPHHHH
HHHHHHAPSQVHMYSYSNEHDPAWAWSPAATPLASVHNAPHAPNGQSAPPPPPPSSASAA
ATNPAAAAAAAAAAAAAAANYAPAIYAGGVAPPQPHPPQATQPPQGSFAVVVHGNDGPYA
MSDSSLGSVPHHSLSPSQMAPYGMPYVPRHDASDAVHATGDPYAQTPRYNDRRVDSHVLP
MYMNQRP
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgtctgcacacaatagtgctgatgcagcactggagaatggtacgtggacagat
gcgcagggggacgactatgtacatggatacgggagtgcggagacggctgtattacaacgt
ccagttgttgatgatagcggcgagagatccgactcgtcggcgtcggcgcccgtcgcgtca
gagacgctcgcgcctgatctgtcgatgtcgtcccacgacacaagcagtcactatgcgcgc
aagatgcgcgagcaaggcgtagaaacgccatctacgacatcgccagtgtccgagcggtcg
actcggtcatcacccgtggtgtcaccgtcacccagtcaagattcgtctgagagctcgtcg
atcgagacggcactcgtgtcggaggagggacctgcgcgcgacgcgacatccagcacgacg
actgccgtttcaataggcacatcgctttcgcaagcgccagcggcaaggcagacgcagatg
cccaagcgcccgggacagccgcaatttgaagggttctggcaagtgcagtcgctcgaggac
ttgcggcctatgcatgacagcagtcagctgtgcgcgaagcaaagacgggctgatccgatt
ggtgggtcggtgagtcccctcaaagccctcacgtcgtacttgcatcatacatatcacctc
gtgaacccagcgttcgtgtatgagctagcgttcaaccctcggcgggtgctgacgaagccc
agcaagccagtgtacaatgatggctatgacaatgaggagagcgactatatcctgtatgtg
aatgactacttgggcaacgaagaggggcatcgctaccttattctagatgtgctgggccaa
ggcacgttcgggcaggtcgtcaagtgccagaacatgtcgaatcacgagatcgtggctgta
aaagtaatcaagaacaagccagcctatttcaaccagagcatgatggaagtgacgatcctc
gagaccctcaaccagcactgggacccggatgaccagcataatattttgcggttgcgcgac
acgtttattcaccacaagcacctatgcttggtatttgagctgctgtcgtccaatctgtac
gagctgatcaagcaaaactctttccgcggactcagtacgagccttgtgcgtgtctttata
tcgcagttgctcgacgctttggtggtactgaaggaagcgcggctgatccattgtgacttg
aagcctgagaatatactcctacggacgctgcaagcgccgtcgatcaagctcgtggatttc
ggttccgcgtgtcatgaagagcagactgtctacacatacatccaaagccgattctaccgc
tcgcctgaggtcctgctgggtttgccatacacatcgtcgatcgacatgtggtcgttggga
tgcatcgccgccgagctattccttgggctccccatttttcctggcacatctgagtataac
cagctgagccgtatcactagcatgctgggtctcccaccggcgttcatgcttgaacgcgga
cgccaaacgcatgaatttttcaacgtacataccgatccatttggtcgcgccatattccag
ctcaaatccatggagcagttttcccgcgagcatcgcgtgcaggagcagcctagcaagcaa
tatttccctggtacaacgctgccggaggtgattcgtctcacgcccatttcgcgacgcagt
ggccgctccgccgacactgataaggagatggccaatcgcgctgctttcaccgactttatc
gccggcttactgaatatgaatccgctcgagcgctggacgccgcagcaggccaagcagcac
ccatttattactggtgagccttacactcagccgtggcagccatcagatgcgtcagccatt
gctgctacagcggccgcggccgctgcggccgctgcggcagctcctcccgctccagagact
gtgcacgcacatgcgcttacacatgcgcccgcacacccccccgttcctggcaccaccggc
cctgcaaccggtccgccgatgccaacgacggcggcagcggccgctgccggggcggctgtc
gccgcaagggcttcttccgtttcagcgacagctacccaaggagctccttccaatttgccg
tcagaggcatcggcggccatccattcgtatgccgagccgccgccgcctgaagacccgtac
gctgtgttgcagcccttcaatcgatcgaatgcgcctcgcgcctatgtgtcgccatcgagc
gcggcgcccgcgaaccataccgcggtgcaatcaccaggtgtcgaagcccaacacatgtat
gatatgagcgccggcgcagcatcaagtgcgtaccatccaacccatccacatcatcatcac
catcatcatcatcaccatgctccatcgcaggtgcacatgtattcatattcgaacgagcat
gaccctgcatgggcttggagccctgcagcgacgcctctggcttccgttcacaatgcacca
catgcacccaacggacagtcagcgccaccgccaccgccaccatcatcagcttcagccgcc
gccacgaatcctgctgccgcggcagcagcagcagcagcagcagcagcagccgcggcgaac
tatgcacctgccatctatgcaggtggcgtagcgccgccacaaccacatccaccacaggcc
acccaaccgccacagggcagctttgccgtcgtcgttcatggcaacgacggtccgtacgcc
atgtccgactcctcgctagggtcagtgcctcatcatagtctatccccatcgcagatggct
ccgtacgggatgccatacgtgccgcggcacgacgcgagtgatgctgtgcatgctacgggc
gatccatatgctcagacgcctcggtacaatgaccgtcgtgttgattcgcatgtcttgccc
atgtatatgaaccaaaggccatag

DBGET integrated database retrieval system