KEGG   Malassezia globosa: MGL_1677Help
Entry
MGL_1677          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MGL_1677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 714 aa AA seqDB search
MAGITLWLVAGLVGLITVFILRNTLFKSQEVAEPIEEDDGDGSNFVERLELQKKRIVIFF
GSQTGTAEEYAIRIAREVKSRYGTSPLVVDPEPEEFDKLDLLPENCVAVFVMATYGEGEP
TDNAVAMMDFLKSPDVAFTNGSTLENLHYVAFGLGNRTYEYFNEAIRQLDARLLELGAHR
IGERGEGDDEKGLEEDYLAWKDPMFEELAAYLELEEGATGDVSDFAVTECDSEMPSVFRG
EYHSRGLMGLSGNHDARNPCPAPVAHTRELFVEGAASRSCVHVEFDISGSGITYQHGDHL
AVWPSNPEPQVERFLAVLGLWEKRHTVINVKSLDPQLAKVPFPVPTTYEAVARYYLDIDA
HASRQALASFAQFAPNEVARDELVRLGKDRDYFRERVSDHCYKIGQVLQLVAGDSLADDD
ILKSTPWPIPFDRVISAIPRLSPRFYSISSSPKLSPDRIHITVVGLRYTPPQASFDTFGL
ASNFLSAVKMAVHDETPALGDPRYGAPLYHLGGPQGKYMSTDESGRKNIKVPVHVRRSNF
RLPTSTKVPIIMVGPGTGVAPFRSFVQERVATARKAKDKLGSEALNDWADLHLYYGCRRS
DEDFLYCDEWGQYAKELNDKLKLRLSFSREVFKPDGSKLYVQDLIWEDREYLADAILNKR
AYIYICGEGKSMCHDVESTLARILGEAKGVDEEAGRAELKQLKERNRMMLDVWS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggctgggattaccctttggctggtggctggtctggtcggtctgattaccgtcttcatt
cttcggaatacactgttcaagtcccaggaagtggctgagcctatcgaagaggatgatggt
gacgggtctaactttgttgaacggcttgagcttcaaaagaagaggatcgttatcttcttc
ggatcgcagacaggcactgctgaagaatacgctatccgtattgcgagagaggtcaaatcg
cgctacggtacatcgcccttggttgtggaccctgaaccggaagaatttgacaaacttgac
ctactgcccgaaaactgtgttgctgtgtttgtaatggccacctacggcgaaggcgaacca
acagacaatgccgtggctatgatggatttcctgaagtcgcccgatgttgcgtttaccaac
ggatcaacgcttgagaatcttcactatgttgcgtttggtcttggtaaccgcacgtacgag
tactttaatgaagcaattcgacagctcgatgcgcgtctgttggagcttggtgctcaccgc
attggtgagcgtggtgaaggcgacgacgaaaaaggtctggaagaagactacctcgcgtgg
aaagaccctatgttcgaggagcttgctgcgtacctggaattggaagaaggcgctaccggc
gacgtgtctgactttgcagtcacggaatgtgacagcgagatgccgtcggttttccgcggc
gaataccattcacgtggtctcatgggtctgagcggcaatcatgatgctcggaatccatgc
ccagcacccgtggctcacactcgtgagttgtttgttgaaggtgcggcatcccgctcatgc
gtgcatgtggaatttgatatcagcggcagtggtatcacttatcagcacggcgaccatttg
gcggtttggcccagcaatcctgagccacaggttgagcgattccttgcggtgctggggttg
tgggagaaacgtcatactgtgatcaacgttaagtcgctggatccgcagctggcaaaagta
ccattccccgtgccgacgacatacgaggctgttgcccgctactacctagacatcgacgca
catgctagtcgccaggcattggcctctttcgctcagtttgcaccgaatgaagtggcgcgg
gatgaactcgtgcgattgggtaaagatcgcgattacttccgcgagcgcgtgtccgatcac
tgttacaagattggccaagtgctacagcttgtggcaggtgattcacttgctgacgatgac
attctcaagtctacaccgtggccaattccttttgatcgtgtaatttccgcgattccccgt
ctatcgcctcgcttctactcaatttcaagcagcccgaaactgtcaccagaccgcattcat
atcaccgttgtgggtctacggtacacaccgccgcaggcatccttcgatacgtttggtctc
gcctcgaacttcttgagcgccgtcaaaatggccgtgcatgatgagacgcctgctctaggc
gatccccgttacggcgctcccttataccatttgggtgggccccagggtaaatacatgtca
acagatgaaagtggtcggaagaacatcaaggtacctgtacatgtgcggcgttcaaatttc
cgtcttccaacctcgacaaaggtgccgatcattatggtaggtccaggaactggcgttgca
ccgttccgttcgtttgtgcaagagcgcgtggcgacggcgcgcaaggctaaagacaaattg
ggctcagaggcgctgaatgactgggctgatctgcacttgtactacgggtgccgtcgaagt
gatgaggacttcttatactgtgacgaatggggccagtatgcgaaagagctcaacgataag
ctcaagctgcggctatcgttttcccgagaggtgtttaaaccagatggctctaaactttac
gtgcaagacctcatttgggaagaccgcgaatacctggccgatgctatcttgaacaagcgt
gcttatatctacatttgtggtgagggtaagagtatgtgccatgatgtagaaagcactttg
gctcgcattcttggcgaagccaagggcgtagacgaagaagctggtcgagcagagctcaaa
caactcaaggagcgcaaccgcatgatgctggatgtatggtcgtaa

DBGET integrated database retrieval system