KEGG   Malassezia globosa: MGL_1714Help
Entry
MGL_1714          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MGL_1714
Transcription machinery [BR:mgl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MGL_1714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 463 aa AA seqDB search
MTQERSECTEDEARKSNVDVQELKTESLPKEKVDGSSTCGIYVQSDTQAPPPCRQAKRRR
TSDSAMNENVSETEHREEKERANAPESVADEFNVPPKREKPAVIEERTGLIQFRVVTNDN
KPESLVILTGLKHIFMKQLPKMPREYITRLVLDRNHWSMAIVKRGLQVVGGITYRPFPHR
EFAEIVFCAISSSEQVKGYGSHLMNHLKDHVKDVSPIKHFLTYADNYAIGYFKKQGFSKD
ISLPRSVWVGYIKDYEGGTLMQCTMVPRVRYLEIHDFLATQKRMIQARISSFSRSHIVYP
GLDVFKQGKKDEKRDITSQASKVEMIVQPNEVPGLRESGWTPEMDELSSRSKRGPHFAVM
RHILVELNGHASAWPFVVPVNANDVPDYYTVITNPMDLSTMESKLENNQYETVDDLVKDA
QLVFDNCKLYNPASSPYAKCAVKLEKFLYERLPQWKQAAGLAV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagaaaggagcgaatgcactgaagatgaagcaagaaaatcgaacgtcgatgtt
caagaactaaaaactgaatcacttccgaaagaaaaagtagatggatcgagtacgtgtggc
atttatgtacagtctgacacccaagcgccgccaccttgtcggcaagcgaaacgccggcgg
acttcggactctgccatgaacgagaatgtatctgagaccgagcatcgtgaggagaaagaa
cgagcaaatgcgccagaatctgtcgcggatgaatttaatgtgccaccgaaacgggagaaa
ccggctgttattgaagagcggacaggtctaattcagtttcgtgtcgttacgaatgataac
aaacctgagtcacttgtaatactcactggattaaagcacattttcatgaagcagcttccg
aaaatgccccgagagtacataacaaggctcgtgcttgatcgaaaccattggagtatggcc
attgtcaagcgtggattacaggtggttggtggcatcacgtacaggccattcccacatcga
gagttcgcagagattgttttctgtgctatttcaagctcagagcaagtcaagggttatggc
tcacaccttatgaatcatctaaaagatcatgtcaaagacgtgtcgcccataaaacacttt
ctaacatatgcggacaactacgctatcggctacttcaaaaagcaaggcttcagtaaggat
atttcattaccacggtctgtctgggtcgggtatattaaagactacgagggcggtacactt
atgcagtgtaccatggtaccccgagtccgatatctggaaatacacgactttcttgcaacc
caaaaacgcatgattcaagcgcgtatcagttctttctcacgctcccatatcgtataccct
ggattggacgtgttcaaacaaggcaagaaggacgaaaagcgagatataacttctcaggca
agcaaagtggagatgattgtgcaaccgaatgaggtgccagggcttagggagtctggatgg
acacctgagatggatgaacttagcagccgatcgaaacggggcccgcattttgctgtgatg
cgccatattcttgttgagctaaatggacatgcgagtgcatggccattcgtggtgccagtg
aatgcaaatgatgttcccgattattacactgtcatcacgaatcctatggatctctctacg
atggaaagcaaattggaaaacaaccagtacgaaacggtggacgatttggtaaaagatgct
caacttgtctttgataactgcaaattatataaccctgcttcgtccccttacgccaagtgt
gcagtcaagctggagaagtttctgtatgaacgattgcctcagtggaaacaggctgcagga
cttgcggtgtga

DBGET integrated database retrieval system