KEGG   Malassezia globosa: MGL_1723Help
Entry
MGL_1723          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
mgl  Malassezia globosa
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGL_1723
Enzymes [BR:mgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MGL_1723
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MGL_1723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MFAESSSVEIIRDSSSFGLPLGDPAASQPHLDLGRKQTPVQTPQSHHTAVLALGANLGDR
ARYIEAAVSSLDAHPSIRVVDTSFLYETAPMYYIDQPRFLNGACKISTSLSPHALLDVCQ
QIERDLGRTKEHVPRNGPRVVDIDIVLYDHEQVTDGERLIIPHARLHERAFVLRPVCDMM
PTYVHPVLQRTMASLLPLTMDGSMTRVMPVKDRMWHWGQQTRVMGILNATPDSFSDGGQH
LDLERALDTARDMVRAGVAILDVGGQSTAPGRVEVSVEEEKARILPLIKAIREDPITQET
PISIDTYRADVAKCALDAGAMIVNDVSGGSRDPQMLVLVAQRHCPFIVMHMRGDASTMTR
LTHYEGGIVNDVRMELQTLVRNALAHGVRRWNLILDPGIGFAKNKQDNLLLLRRLPELVD
HCAAGMLRECASPEVHDTTQLHEGPCMSLAHIPVLLGVSRKRFLGDLVHAPSSDPALRMQ
ASIAACVATMATGCVDLIRVHDVAQAMDAVRTSDAIWRN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgagtcctccagcgtggaaattataagggatagctccagcttcggtcttcct
ctcggagacccggccgcatcacaaccacatctggacctgggccgaaaacaaacgcccgtg
cagacgccccagtcccatcatactgctgtgttggcactaggcgcgaatcttggagaccgc
gctcgttatatcgaagcggctgtctcatctttggatgcgcatccgagcattcgtgtcgtc
gatacctcttttctctatgaaacggcccccatgtactacatcgaccagcctcgattcctt
aatggtgcatgcaaaatttccacttctctttcgccacatgcattgctagatgtgtgccag
cagattgaacgggatcttggtcgtaccaaggaacatgtaccgcgaaatgggcctcgtgtc
gtggacattgatattgtcctgtatgaccatgaacaggttacagatggcgagcgactgatc
attccacatgcgcgtctgcatgaacgtgcatttgtgctccgtcctgtgtgtgacatgatg
ccgacgtacgtacatcctgttctccagcgcacgatggcatcattgctacccttgaccatg
gacggttccatgacacgtgtgatgcccgtcaaagaccgcatgtggcattggggccagcaa
actcgcgtaatgggcatattgaatgcgacgcctgactcattctcagatggcggtcagcac
ttggatctggagcgggcgttggacacagcccgtgatatggtccgagcgggggtggcgatt
ttggacgtaggcggtcaaagcacggctcctggccgtgtagaagtgtctgtcgaagaagaa
aaggcacgaattcttccactaatcaaggcgattcgcgaagatcctatcacacaggagaca
cccatctccatcgatacgtaccgagcagacgtggccaagtgcgccttagatgctggagcg
atgattgtgaatgacgtcagtggaggctcaagagacccacaaatgcttgtgctcgtggca
caacgccactgtccatttatcgttatgcatatgcgtggtgatgcgtcgaccatgacacgc
cttactcattacgaaggtggcattgtgaatgatgtccgcatggagttgcaaacactcgtc
cgaaatgcattagctcacggagtgcgtcgatggaacctgatcttggatccaggaattgga
tttgcaaaaaacaaacaagataacttgcttttgctgcgccgtttgccagagcttgtagat
cattgcgcagcaggtatgttgcgtgagtgtgctagtccggaagttcacgatacgacgcaa
ttgcatgagggcccgtgtatgtcactcgcacatatacctgtgttactgggagttagccgc
aagcggttccttggtgatttggttcatgcgccatcctccgacccagcattgcgaatgcaa
gcaagcatcgctgcttgcgtcgctaccatggccaccggttgcgtcgacttaatccgtgtt
cacgacgttgcacaagctatggatgccgtgcgaacatccgacgccatttggcgcaattaa

DBGET integrated database retrieval system