KEGG   Malassezia globosa: MGL_1723Help
Entry
MGL_1723          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
mgl  Malassezia globosa
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgl00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MFAESSSVEIIRDSSSFGLPLGDPAASQPHLDLGRKQTPVQTPQSHHTAVLALGANLGDR
ARYIEAAVSSLDAHPSIRVVDTSFLYETAPMYYIDQPRFLNGACKISTSLSPHALLDVCQ
QIERDLGRTKEHVPRNGPRVVDIDIVLYDHEQVTDGERLIIPHARLHERAFVLRPVCDMM
PTYVHPVLQRTMASLLPLTMDGSMTRVMPVKDRMWHWGQQTRVMGILNATPDSFSDGGQH
LDLERALDTARDMVRAGVAILDVGGQSTAPGRVEVSVEEEKARILPLIKAIREDPITQET
PISIDTYRADVAKCALDAGAMIVNDVSGGSRDPQMLVLVAQRHCPFIVMHMRGDASTMTR
LTHYEGGIVNDVRMELQTLVRNALAHGVRRWNLILDPGIGFAKNKQDNLLLLRRLPELVD
HCAAGMLRECASPEVHDTTQLHEGPCMSLAHIPVLLGVSRKRFLGDLVHAPSSDPALRMQ
ASIAACVATMATGCVDLIRVHDVAQAMDAVRTSDAIWRN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgagtcctccagcgtggaaattataagggatagctccagcttcggtcttcct
ctcggagacccggccgcatcacaaccacatctggacctgggccgaaaacaaacgcccgtg
cagacgccccagtcccatcatactgctgtgttggcactaggcgcgaatcttggagaccgc
gctcgttatatcgaagcggctgtctcatctttggatgcgcatccgagcattcgtgtcgtc
gatacctcttttctctatgaaacggcccccatgtactacatcgaccagcctcgattcctt
aatggtgcatgcaaaatttccacttctctttcgccacatgcattgctagatgtgtgccag
cagattgaacgggatcttggtcgtaccaaggaacatgtaccgcgaaatgggcctcgtgtc
gtggacattgatattgtcctgtatgaccatgaacaggttacagatggcgagcgactgatc
attccacatgcgcgtctgcatgaacgtgcatttgtgctccgtcctgtgtgtgacatgatg
ccgacgtacgtacatcctgttctccagcgcacgatggcatcattgctacccttgaccatg
gacggttccatgacacgtgtgatgcccgtcaaagaccgcatgtggcattggggccagcaa
actcgcgtaatgggcatattgaatgcgacgcctgactcattctcagatggcggtcagcac
ttggatctggagcgggcgttggacacagcccgtgatatggtccgagcgggggtggcgatt
ttggacgtaggcggtcaaagcacggctcctggccgtgtagaagtgtctgtcgaagaagaa
aaggcacgaattcttccactaatcaaggcgattcgcgaagatcctatcacacaggagaca
cccatctccatcgatacgtaccgagcagacgtggccaagtgcgccttagatgctggagcg
atgattgtgaatgacgtcagtggaggctcaagagacccacaaatgcttgtgctcgtggca
caacgccactgtccatttatcgttatgcatatgcgtggtgatgcgtcgaccatgacacgc
cttactcattacgaaggtggcattgtgaatgatgtccgcatggagttgcaaacactcgtc
cgaaatgcattagctcacggagtgcgtcgatggaacctgatcttggatccaggaattgga
tttgcaaaaaacaaacaagataacttgcttttgctgcgccgtttgccagagcttgtagat
cattgcgcagcaggtatgttgcgtgagtgtgctagtccggaagttcacgatacgacgcaa
ttgcatgagggcccgtgtatgtcactcgcacatatacctgtgttactgggagttagccgc
aagcggttccttggtgatttggttcatgcgccatcctccgacccagcattgcgaatgcaa
gcaagcatcgctgcttgcgtcgctaccatggccaccggttgcgtcgacttaatccgtgtt
cacgacgttgcacaagctatggatgccgtgcgaacatccgacgccatttggcgcaattaa

DBGET integrated database retrieval system