KEGG   Malassezia globosa: MGL_1812Help
Entry
MGL_1812          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGL_1812
Peptidases [BR:mgl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MGL_1812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
MTTASAPTSWVPLEANPDLFSTWCETLGLDTSKYAFYDVFGLDDELLAMVPQPVEAVLFL
FPLTSRIEAHRSGLQKKADEKSELLWFPQTIGNACGTIGLLHAIANSAAAQAIRPESVLA
HLLARARSVPPAERANLLLQCEDLRSAHASTAAQGQTAAPTAEDDVDLHFVAFVRSSTGA
LVELDGRQDGPVERVPYIERNELLSRTAHVIQQDYMAVDPDQVQFSVVALSQSV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccagtgcaccgacatcatgggtgccgctcgaggcgaatccagacttgttt
agcacgtggtgcgagacattaggcctcgatacgtcgaagtatgcattctatgatgtgttt
ggtcttgacgatgagctcttggcgatggtgcctcagcctgtggaagcggtcctatttcta
tttccactgacatcgcgcatcgaagcgcatcgaagcggactacaaaagaaggctgatgaa
aaaagcgagcttctttggtttccacagacgatcggcaatgcatgcggcaccataggtctg
ctgcacgctattgccaactcggcggcagctcaagcgattcgaccagagtcggtattagcg
cacctgcttgctagggcgcgatctgttcctcctgctgaacgagctaatcttttgcttcaa
tgtgaagaccttcgatcagctcacgcatccaccgctgcgcagggccaaacagccgcaccg
acggcggaagatgacgtcgatttgcactttgttgcctttgtacgcagttcgactggtgcg
cttgttgagctagatggtcgtcaggatggtcctgttgagcgcgttccatacattgagcgc
aatgagctgctatccaggacagcacacgttattcagcaggattacatggctgttgatccg
gatcaggtccaattttccgtcgtagcgctgagccaaagtgtgtaa

DBGET integrated database retrieval system