KEGG   Malassezia globosa: MGL_2066Help
Entry
MGL_2066          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGL_2066
Translation factors [BR:mgl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MGL_2066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MSDWENDDNVQPQAPAFVPRRRFEDEDLEDDDVKDDWEEEDEEPKPAPAPAPEPKKRLSV
KQKIAEKEAMKQNNTGNDFDDWELEQPQENEDERRRREKEAQIRSDLDNAATLLGSTSLD
AKKDNLAVDSQTVSLSDAKPSSKEDWEAFAKSLYDKLILPKASRPGFDKHFFPKMITLLT
TNGLRDVDMRKGSTKLRELAEAKVKADKDMKRTGGNLRNLQNAKPKQVGTSSAKNTFDLK
AYGDEALDDDLDFM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattgggaaaacgatgataatgttcagccccaagcgcctgcttttgtccctcgt
cgccgcttcgaagatgaagacttggaagacgacgacgtgaaagatgattgggaagaggaa
gacgaagagcccaagcctgctcccgctcctgctcctgagccaaagaagcgactttctgtg
aagcaaaagattgcagagaaggaggccatgaagcagaataacacaggaaatgactttgat
gattgggagctagaacagccccaagaaaatgaagacgagcgtcgaagacgcgaaaaagaa
gcacaaatacgctctgatctggacaatgctgcaaccctccttggcagcacctcgcttgac
gcgaaaaaggacaatcttgcagtagactcccagactgtgtccctctctgatgccaagccc
agcagcaaagaggactgggaagcgttcgccaagtctctttatgataaacttattcttccc
aaagcaagtcgccctggctttgacaagcactttttccccaagatgatcacactcctgacg
acgaatggtctgcgtgacgttgacatgcgcaaaggttcaaccaagctgcgtgagctcgct
gaggcaaaggtcaaggccgataaagacatgaaaaggactggcggtaacctgcgcaacctg
caaaatgccaagccaaaacaggttggcacaagcagcgcgaaaaatactttcgaccttaaa
gcatacggcgatgaagcactcgatgatgaccttgactttatgtag

DBGET integrated database retrieval system