KEGG   Malassezia globosa: MGL_2066Help
Entry
MGL_2066          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mgl03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 254 aa AA seqDB search
MSDWENDDNVQPQAPAFVPRRRFEDEDLEDDDVKDDWEEEDEEPKPAPAPAPEPKKRLSV
KQKIAEKEAMKQNNTGNDFDDWELEQPQENEDERRRREKEAQIRSDLDNAATLLGSTSLD
AKKDNLAVDSQTVSLSDAKPSSKEDWEAFAKSLYDKLILPKASRPGFDKHFFPKMITLLT
TNGLRDVDMRKGSTKLRELAEAKVKADKDMKRTGGNLRNLQNAKPKQVGTSSAKNTFDLK
AYGDEALDDDLDFM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattgggaaaacgatgataatgttcagccccaagcgcctgcttttgtccctcgt
cgccgcttcgaagatgaagacttggaagacgacgacgtgaaagatgattgggaagaggaa
gacgaagagcccaagcctgctcccgctcctgctcctgagccaaagaagcgactttctgtg
aagcaaaagattgcagagaaggaggccatgaagcagaataacacaggaaatgactttgat
gattgggagctagaacagccccaagaaaatgaagacgagcgtcgaagacgcgaaaaagaa
gcacaaatacgctctgatctggacaatgctgcaaccctccttggcagcacctcgcttgac
gcgaaaaaggacaatcttgcagtagactcccagactgtgtccctctctgatgccaagccc
agcagcaaagaggactgggaagcgttcgccaagtctctttatgataaacttattcttccc
aaagcaagtcgccctggctttgacaagcactttttccccaagatgatcacactcctgacg
acgaatggtctgcgtgacgttgacatgcgcaaaggttcaaccaagctgcgtgagctcgct
gaggcaaaggtcaaggccgataaagacatgaaaaggactggcggtaacctgcgcaacctg
caaaatgccaagccaaaacaggttggcacaagcagcgcgaaaaatactttcgaccttaaa
gcatacggcgatgaagcactcgatgatgaccttgactttatgtag

DBGET integrated database retrieval system