KEGG   Malassezia globosa: MGL_2158Help
Entry
MGL_2158          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
mgl  Malassezia globosa
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MGL_2158
   03420 Nucleotide excision repair
    MGL_2158
   03430 Mismatch repair
    MGL_2158
   03440 Homologous recombination
    MGL_2158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 280 aa AA seqDB search
MDEYSGNPFGQHYAGYMDDGKSVGGGFLGGSQGGEAGQRRLGTNWLRPVTVRQVLNATQP
DSDSPFEFDGAELSQVTLVAWIRQTNRNATNIQYTLDDGTGQLDVRQWIDNALDEGAKAD
EFAPNQFVRVLGEIKSFNNKRNITAATVNKLEDHNEYLYHQLDVIYTHLQLIKAEGMRST
KTDVSSTHGIDASVYDDSAMQTADSMAADLSSLSPLQRRIYQAIAAEAPDWPEGVDVQQI
IKRCSKHADVTQIQDAIDELANDGYIYQASDDTHYLTTAG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggacgaatacagcgggaatccattcggacaacattatgcagggtacatggatgatgga
aagagtgtcggcggcgggttccttggtggaagtcagggtggcgaggctggacaacgccgt
ttgggaacgaactggctaagacctgtcacagtgcggcaggtattaaatgcaacacagcca
gactcagactcaccgttcgagttcgatggtgctgagctcagtcaggtcacattggtggca
tggatccgccaaaccaatcgtaatgccaccaatatccaatacactttggacgatggaaca
ggtcaactcgatgtgcgacaatggatagataatgctcttgacgagggtgcgaaggctgat
gagtttgcaccgaatcagtttgtgcgtgtattgggtgaaattaagtccttcaacaataaa
cgcaatattacagcggccacggtcaacaagcttgaagaccataacgagtacctctatcac
caactagatgtgatatacacgcatctgcagcttatcaaagccgagggtatgcgaagcacc
aaaacagacgtgtcatctacacacggcatagatgcgtctgtctatgacgactccgctatg
cagacagccgacagcatggcagctgatttatccagcttgtctccgttacaaaggcggatc
taccaagctattgctgccgaagcaccagactggcccgaaggtgtcgatgtacagcagatt
ataaagcgctgtagcaaacatgccgatgttactcaaatccaggatgccattgatgaactt
gcgaatgatggctatatctaccaagcgagcgatgacacgcattacctcacgaccgctggg
tag

DBGET integrated database retrieval system