KEGG   Malassezia globosa: MGL_2158Help
Entry
MGL_2158          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  
replication factor A2
Organism
mgl  Malassezia globosa
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MGL_2158
   03420 Nucleotide excision repair
    MGL_2158
   03430 Mismatch repair
    MGL_2158
   03440 Homologous recombination
    MGL_2158
DNA replication proteins [BR:mgl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    MGL_2158
DNA repair and recombination proteins [BR:mgl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     MGL_2158
   MMR (mismatch exicision repair)
     MGL_2158
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     MGL_2158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 280 aa AA seqDB search
MDEYSGNPFGQHYAGYMDDGKSVGGGFLGGSQGGEAGQRRLGTNWLRPVTVRQVLNATQP
DSDSPFEFDGAELSQVTLVAWIRQTNRNATNIQYTLDDGTGQLDVRQWIDNALDEGAKAD
EFAPNQFVRVLGEIKSFNNKRNITAATVNKLEDHNEYLYHQLDVIYTHLQLIKAEGMRST
KTDVSSTHGIDASVYDDSAMQTADSMAADLSSLSPLQRRIYQAIAAEAPDWPEGVDVQQI
IKRCSKHADVTQIQDAIDELANDGYIYQASDDTHYLTTAG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggacgaatacagcgggaatccattcggacaacattatgcagggtacatggatgatgga
aagagtgtcggcggcgggttccttggtggaagtcagggtggcgaggctggacaacgccgt
ttgggaacgaactggctaagacctgtcacagtgcggcaggtattaaatgcaacacagcca
gactcagactcaccgttcgagttcgatggtgctgagctcagtcaggtcacattggtggca
tggatccgccaaaccaatcgtaatgccaccaatatccaatacactttggacgatggaaca
ggtcaactcgatgtgcgacaatggatagataatgctcttgacgagggtgcgaaggctgat
gagtttgcaccgaatcagtttgtgcgtgtattgggtgaaattaagtccttcaacaataaa
cgcaatattacagcggccacggtcaacaagcttgaagaccataacgagtacctctatcac
caactagatgtgatatacacgcatctgcagcttatcaaagccgagggtatgcgaagcacc
aaaacagacgtgtcatctacacacggcatagatgcgtctgtctatgacgactccgctatg
cagacagccgacagcatggcagctgatttatccagcttgtctccgttacaaaggcggatc
taccaagctattgctgccgaagcaccagactggcccgaaggtgtcgatgtacagcagatt
ataaagcgctgtagcaaacatgccgatgttactcaaatccaggatgccattgatgaactt
gcgaatgatggctatatctaccaagcgagcgatgacacgcattacctcacgaccgctggg
tag

DBGET integrated database retrieval system