KEGG   Malassezia globosa: MGL_2190Help
Entry
MGL_2190          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mgl  Malassezia globosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MNSSDTNVPHNTLPSFQPQAPMRNMNKDPADIPLLGGSYKLVKTIGEGAYGVVYSAIHVP
TSTRVAVKRISPFDHQMFCLRTLREIRLLRHFHHENIISILDILPPGSLETFTEVYLVQE
LMETDMHRVIRTQDLSNDHFQYFVYQILRGLKALHSAGVLHRDLKPSNLLLNANCDLKIC
DFGLARSAEQPEPESKAFLTEYVATRWYRAPEIMLSFKEYTKAIDQWSVGCIFAEMLTGR
PLFPGRDYHHQLSLILGVLGTPSLEDFYSITSARSREYIRSFPYCERANFAELFPRAEPL
ALDLLDKLLTFSPQKRLTVEEALSHPYLEPYHDPSDEPGAEPLDPSFFDADFSKEPLSRA
QLKELIYREITR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcggataccaatgtgccacacaacacactacctagcttccagccgcaggcc
ccgatgcggaacatgaacaaagatccggcagacattcccttgctaggtggctcatacaaa
cttgtgaagacgatcggagagggcgcgtatggtgttgtatactctgccattcatgtaccc
acatctacacgggtggcagtgaagcggatctcgccgtttgatcaccaaatgttctgtctt
cgtacgttacgtgagatccgcctgctacgccatttccatcacgagaacataatttcgatc
ctcgatattctaccccccgggtcgctggagacctttaccgaagtgtaccttgtgcaagag
ctgatggaaacagatatgcaccgagttattcggacgcaggacttgtcgaatgaccatttc
cagtatttcgtgtaccagattcttcgtgggctcaaggcactgcactcagctggggtgcta
caccgtgacttgaagccatcgaatttgctgttgaatgcgaattgcgatctgaaaatttgt
gatttcggtctggcgcgcagtgctgagcagcccgagccggagagcaaggcgttcctgaca
gagtatgtggctacgcgatggtaccgagcacctgagattatgctttcgtttaaggaatac
accaaggccattgatcagtggtctgtgggatgcatctttgcagaaatgctcacgggacga
ccgttgttcccaggacgcgactaccaccaccagctctcactcattctcggtgtgctagga
acaccgtccttggaagacttctactctattacatcggctcgctcgagagagtatatccgt
tcatttccgtattgtgagcgagcgaactttgcggagctgtttccgcgcgcagagccactc
gcacttgacttgcttgacaagctcttgacgttctcgcctcaaaagcgtcttactgtggaa
gaggcactatctcatccgtacttggagccgtaccatgatccaagtgacgagccgggggcg
gagccactggacccgagcttttttgacgccgacttttcgaaggagccgctttctcgtgcc
caactcaaggaattgatctaccgagaaattacgcgctaa

DBGET integrated database retrieval system