KEGG   Malassezia globosa: MGL_2243Help
Entry
MGL_2243          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mgl  Malassezia globosa
Pathway
mgl00330  Arginine and proline metabolism
mgl00332  Carbapenem biosynthesis
mgl01100  Metabolic pathways
mgl01130  Biosynthesis of antibiotics
mgl01230  Biosynthesis of amino acids
Module
mgl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MGL_2243
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MGL_2243
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MGL_2243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 5854754
NCBI-ProteinID: XP_001730447
UniProt: A8Q2V3
AA seq 404 aa AA seqDB search
MRRKTVVIKLGSSSILSESTLEPKIRIMSSIVEAVSQLRQNGHRVVLVCSGAIGLGRIRM
NIKTKPKNLGERQALAALGQLRLMTLWDNLFGMLGINIAQVLLTRSDLADSPRYVNARTT
LDTLLMDNFYAVPIVNENDTVSVFEMRFGDNDSLSAITAGIIDADYLFLCTDVDGLYTDN
PRTRPDAHRLHVVRNMDEARKATCVKTMGSSFGTGGMQTKLVAAELAMAAGVATVILNGA
HPENIVRIVEQDIVAQASSRSDMQLVDPPCTLFLPQRQRLPAQKWQILHAMHPCGALIID
RGAYERISRKESGGRLLPAGVVGVEGNWERLQAVRLKVRQGQNEDDASEAPTSFEVGRAL
ANYTSIECERIKGLQSSQIADVIGAMDTMYITDHIVLSLPSAAT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcaaaacggtcgtgatcaagctcggttcatcatcgattctctctgaatcgacc
ttggagcccaaaatccgcatcatgtcgtccatcgttgaggccgtgtcgcagcttcgacag
aacggacaccgtgtggtgttggtctgctcaggagcaattggcttgggtcgcattcgcatg
aacattaagacgaagccaaagaatcttggagagcgccaggctctagcagcgcttggacag
ctgcggctgatgacactgtgggacaatttgtttggcatgctgggcatcaacatagctcaa
gttctattgacacgttcagatttggcagatagcccgcggtacgtgaatgcgcgcacgaca
cttgatactcttcttatggacaacttttatgccgtaccaattgtcaatgaaaatgacacc
gtgtctgtattcgaaatgcgatttggtgataatgactcgttgtcagcaatcacggctggc
attatcgatgctgattacctttttctgtgcacggatgtagatggtctttacaccgacaat
ccacgcacgcgtcccgatgcacacagacttcatgtcgtgcgcaacatggacgaagctagg
aaagccacgtgcgtcaagacgatgggttcctcgtttggcactggcggtatgcaaaccaaa
ctagtggctgctgaactagccatggccgccggcgtagccacggtcattctgaatggcgca
catcctgaaaacatcgtccgcattgtggagcaggacattgtggcacaggcgagcagtaga
tctgatatgcaacttgtcgaccctccgtgtacactatttcttcctcagcgtcaacggcta
ccggcgcagaaatggcagattctccacgcgatgcacccatgtggtgcgttgatcatcgat
cgcggcgcgtacgagcgaatttcacggaaagagtcgggtggtcgtctcctgcctgctggt
gtggtgggagttgaaggcaactgggaacgacttcaagctgtgcgactcaaagtccggcaa
ggccagaacgaagacgacgcttctgaagcgcctacatcattcgaggtgggtcgcgctctc
gccaactacacctccatcgagtgtgagagaatcaagggactccagagttctcagatagca
gatgtcattggtgctatggatacgatgtacatcacagatcatatagtgttatcattgcca
tctgcagccacatag

DBGET integrated database retrieval system