KEGG   Malassezia globosa: MGL_2408Help
Entry
MGL_2408          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     MGL_2408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 428 aa AA seqDB search
MSDLEKVPMDGSSSFEALRGDASASKEDNHVPNTRTVQLHVSGMTCGSCVASIEKMLGQK
PGIESVTVALLAERATVVYDAASTWTPDKLVEAIDDIGFDAQVVPERAEDAVTLSVFGMT
CSSCTSSLEHALMRVDGVVSCNVSLTLQRAQIEFDHHRTSVRALVEAVEDAGFDAIVFDD
RDEAQIESLTHVHEMHDWLHAFMISLLFAVPEFLVCMVLMHVRLLRPFLIMQPVRGLYMQ
DVLGLLLTLPVQFGVGQRFFRAAYKAIRHGSMTMDTLVVIGTMASWTFSVLAMLMMLGCT
DHCEKPRTFFDTSTMLITFVSLGRYLESSAKGQTGQALTRLIQLAPQKATIYTDEHHQTE
RVIPAELLQVGDTVKLVPGEKIAADGIVRHGQSFVDESMVTGEHVPVHKTVGAQVLGRHR
QWQWNARL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacctcgaaaaggtgccgatggatgggtctagttcgttcgaagctctgcgaggt
gatgcaagtgcctcgaaagaagacaatcacgtacccaacacgcgcactgtccaactgcat
gtgagtggtatgacttgcggttcatgtgtggcaagtatcgaaaaaatgctggggcagaag
ccggggatcgagtctgtgactgtggctctgcttgcggagcgtgcaacggttgtgtatgat
gctgcatctacctggacgcctgacaagctcgtcgaggccattgatgacattggcttcgat
gctcaggtcgtgccggagcgtgcagaggacgccgttacactttcagtatttggcatgacg
tgcagttcttgcacatcttcgctagagcatgcgcttatgagagtcgatggcgtcgtgtca
tgtaacgtctcgctcacactccagagagcacaaatcgagttcgatcaccaccgaacaagc
gtgcgcgcgcttgttgaggcagtggaagatgctggatttgatgcgattgtatttgatgat
cgggacgaagcgcagatcgagagtctcacgcatgtgcatgagatgcatgattggctacat
gcattcatgatctcgttattgtttgccgtgcctgagtttcttgtctgtatggtgttaatg
cacgtacggcttcttcgaccatttctcataatgcagcccgtgcgcggcctgtatatgcag
gatgtacttggcctcttacttacgctgcccgtgcaatttggtgtggggcaacggttcttc
cgagcggcatacaaggccattcgccatggttctatgactatggatacacttgtcgttatc
ggaacgatggcctcttggacgttcagcgtcctcgccatgctcatgatgcttggctgcacc
gaccactgtgaaaagccacgtaccttctttgatacgtcaaccatgctcattacctttgtg
tcgttgggtcggtacttggaaagctcggcgaaaggccagacgggccaggctctcacacgc
ctcattcagctcgccccacagaaagccacgatttacacggatgagcaccaccagacagag
cgagtcatcccggcagaactgctccaggttggcgatacagtgaaacttgtgccgggagaa
aaaattgcagcggatggtatcgtccggcatggccagagcttcgttgatgaaagcatggtc
acgggcgagcatgtgcctgtgcacaagaccgtcggtgcccaggtgttggggcggcaccgt
caatggcagtggaacgctcgactttga

DBGET integrated database retrieval system