KEGG   Malassezia globosa: MGL_2569Help
Entry
MGL_2569          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgl  Malassezia globosa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mgl00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mgl04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1020 aa AA seqDB search
MSMPLSMPPTTADIHRHHRHRTRPTTPPTPPTPPTPPTPPTPPTPPTPPTPPTLPTPSTP
PLATTFRFLPARYTAWKESTRAFKAMRHNRSAQTTLPPVCVSPVPSVVAFEPLDAMIPIT
MRQGERMLKVTQNKVAMRLFRVDTESASIVWESKRGNSVRLYAVRDVRVGESARSYRHSL
QISDEHEPRWISIIYQTARAYKAVHMVALSDESLARWRDSLLRILAQWHALVSGRVTASR
AQGEWLQASWDVEKRLDQSALARLCQRMGVQISRPELDTLFLEADRERVGALNFEAFQRF
VAALKRRPDVEQLFYQLAKRDAQESCSISLSSFTSFLHREQGEWKWTSDDIAHIYQRYRV
DTLDGFAAFLMSRDNGAYNDPVLSGGEAAGKEKESGSLHARTQASSGRLDEPLSSYYISS
SHNTYLEGGQWKGDSTVEGYVRALHKGARCVELDCWDGPGGQPQVTHGHTLTSRVPLDDV
VAAVAQYAFVASPYPLILSLEVHNDLAQQVVLANILQARLGDMLVTAPLDDDVQPGMLPS
PEQLRFRILVKCKDHVWIHSQVSQDADDQQPLPQGRSSSSTEQTEWESDSFLDQARNLVR
LARHRTERGKIARPLARELVRLLVYTVGVPFRGLNKKEQYAAEHMFSLSERSAARLMRQS
HADLVKHNLTHLTRVYPSMTKLSRLTSSANFLPMDMWASGCQLVALNWQTHDQGMSQNLA
LFARSAGYVRKPSALRVRSCLKNDGGTLLVSCVLTIVSAQQVPHMRSADEAVCPYATVSA
DVPQQWGKDAVQVSVPAAVPRESPSMATCQGDSLAGCTASGLAASGAGSRTRSTGSGSGS
TTRAASLGSTPSPSTSLLPSSSSSSASSTGVANLLPPISSSAPVSSRRSPFRTPAVRSNG
LNPVWQTSFLLDIRMPAGHDAKAIVLQRAQRLKHGKERTDDPCVWEDVTRGLLHLCFVQV
QICDEQTSSQVPLATTTLSLGRLRHGYRHVPLYDMQLSPLMYSSLFVHTSYTHMEVLPST
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgccattgtccatgccaccgacgaccgctgacattcaccgacatcaccgacac
cggacgagacccacgacaccaccgacaccaccgacaccaccgacaccaccgacaccaccg
acaccaccgacgccaccgacgccaccgacgccaccgacgctaccgacgccatcgacgccg
ccactagcgacgacttttcgttttcttcctgcgaggtacacggcatggaaagaatcgaca
cgtgctttcaaagccatgcgacacaacagatcggctcagacgactctgccacccgtttgt
gtttcgcctgtaccctctgttgtggcatttgagcctttggatgccatgatacccattacg
atgcgtcagggcgagcgcatgctgaaagtaacgcaaaacaaggtggcgatgcgtttgttc
cgcgtcgacactgagtcggcatcgatcgtgtgggaaagcaagcgagggaattctgtgcgt
ctgtatgcggtgcgcgatgtgcgtgttggcgaatctgcgcgctcataccgtcactcgttg
cagatttctgacgagcatgagccacgctggatctcgatcatctaccagacggcgcgggct
tacaaggctgtacacatggtggcgttatctgatgaatcactcgctagatggcgcgattcg
ctcctgcgcattcttgcgcaatggcatgcgcttgtatcagggcgcgtgacagcatcgcgt
gcacagggtgaatggctccaggcgtcctgggatgtagagaagcgacttgatcagagcgcg
cttgcgcggctgtgtcagcggatgggtgtgcagatcagtcggcccgagcttgacacactg
tttctggaggctgatcgggagcgtgtaggagcgctgaactttgaggcattccagcgtttc
gtcgctgcactgaagcggcgaccagacgttgagcagctgttttaccagctggccaagagg
gatgcgcaagagtcctgttcgatttcgcttagctcattcacctcgttcctgcatcgtgag
cagggcgagtggaagtggacatccgacgatattgcccacatctatcaacgctaccgggtc
gacaccctggatgggtttgcggcgtttctcatgtcgcgagacaatggcgcgtacaatgat
cccgttttgtctggaggcgaagcggcaggaaaagagaaggaaagtggaagccttcatgcg
aggactcaagcatcgagcggccgactggatgagccattaagcagctattatatatcgtca
agtcataacacatacctggagggcgggcaatggaaaggcgatagcactgtcgaaggctat
gtacgtgcactgcataaaggcgcccggtgcgttgagctcgactgctgggacgggcctggc
ggacagccacaggtcacacatggacatacactcaccagtcgcgtgcccttggacgatgtg
gtggcggccgtggcacaatatgcgtttgtcgcttcgccgtacccactgattctttcgttg
gaagtgcataatgatcttgcacagcaagttgttctggccaacattttgcaggcgcggctg
ggcgacatgcttgtgacggcgccattggacgacgatgtccagccagggatgctaccaagt
cctgaacagcttcgcttccgcatccttgtcaagtgcaaggaccatgtttggattcattct
caagtttcacaagatgcggacgaccagcagccgctgccccaggggcgtagctcctcctcg
actgaacagacggaatgggaaagcgattcatttttggatcaagcgcggaatcttgtacgt
ctcgcgcgacatcgcaccgagcgagggaaaatcgctcggcctctcgctcgtgagcttgtg
cgccttctcgtgtataccgtcggcgtgccattccgcggactcaacaagaaagaacagtat
gctgctgagcatatgttctctctatccgagcgctctgcggcgcggctcatgcggcagagc
catgcagacttggtcaaacacaacctgacgcatttgacgcgtgtctatccatcgatgacg
aagctaagccgcctcacgtccagcgcgaatttccttcccatggacatgtgggcatcgggc
tgccagcttgtggctctgaattggcagacacacgaccaaggtatgtcacagaacttggct
cttttcgcgcggagtgccggctatgtccgcaagccgagtgccctgcgtgtgaggagctgc
ttgaagaatgacggcggcacactgcttgtatcgtgcgtgctgaccatcgtgtcggcgcag
caggttccacacatgcggagcgcagacgaggcggtgtgtccgtatgcgacggtaagcgcg
gatgtaccccaacaatggggcaaagatgccgtgcaagtgtctgtaccagcggcggtgccg
agggaatcgccatctatggccacgtgtcaaggcgactccctcgcaggctgtacggcttca
gggcttgccgcgtctggtgctggaagtcgaaccagatctacaggctcaggatcaggatct
accacaagagcggcttcgttgggctcgacacccagtccctcgacgtcgttgttaccgtcg
tcttcgagctcgtctgcctctagcacaggcgttgccaacctgcttccacccatctcatca
tcggcaccggtatcatcacgccgcagtcctttccgcacgccggccgtgcgatcgaatgga
cttaatcccgtgtggcaaacttcgtttttgctagacatacgtatgccagcaggacacgat
gccaaagcgatcgtcctgcaacgagcgcagcggcttaagcatggcaaggaacgaacagac
gatccatgcgtgtgggaagacgtgactcgtggactcttacatttgtgcttcgttcaagtg
caaatttgtgatgagcagacaagcagccaagtaccactcgcaacgacgacgctaagtctc
ggccgtctccggcatggctaccgacatgtcccgctgtatgacatgcagctttcgccgctc
atgtattcctctttgttcgtgcacacatcctatacccatatggaggtccttccctcgacg
tag

DBGET integrated database retrieval system