KEGG   Malassezia globosa: MGL_2569Help
Entry
MGL_2569          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgl  Malassezia globosa
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    MGL_2569
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    MGL_2569
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     MGL_2569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1020 aa AA seqDB search
MSMPLSMPPTTADIHRHHRHRTRPTTPPTPPTPPTPPTPPTPPTPPTPPTPPTLPTPSTP
PLATTFRFLPARYTAWKESTRAFKAMRHNRSAQTTLPPVCVSPVPSVVAFEPLDAMIPIT
MRQGERMLKVTQNKVAMRLFRVDTESASIVWESKRGNSVRLYAVRDVRVGESARSYRHSL
QISDEHEPRWISIIYQTARAYKAVHMVALSDESLARWRDSLLRILAQWHALVSGRVTASR
AQGEWLQASWDVEKRLDQSALARLCQRMGVQISRPELDTLFLEADRERVGALNFEAFQRF
VAALKRRPDVEQLFYQLAKRDAQESCSISLSSFTSFLHREQGEWKWTSDDIAHIYQRYRV
DTLDGFAAFLMSRDNGAYNDPVLSGGEAAGKEKESGSLHARTQASSGRLDEPLSSYYISS
SHNTYLEGGQWKGDSTVEGYVRALHKGARCVELDCWDGPGGQPQVTHGHTLTSRVPLDDV
VAAVAQYAFVASPYPLILSLEVHNDLAQQVVLANILQARLGDMLVTAPLDDDVQPGMLPS
PEQLRFRILVKCKDHVWIHSQVSQDADDQQPLPQGRSSSSTEQTEWESDSFLDQARNLVR
LARHRTERGKIARPLARELVRLLVYTVGVPFRGLNKKEQYAAEHMFSLSERSAARLMRQS
HADLVKHNLTHLTRVYPSMTKLSRLTSSANFLPMDMWASGCQLVALNWQTHDQGMSQNLA
LFARSAGYVRKPSALRVRSCLKNDGGTLLVSCVLTIVSAQQVPHMRSADEAVCPYATVSA
DVPQQWGKDAVQVSVPAAVPRESPSMATCQGDSLAGCTASGLAASGAGSRTRSTGSGSGS
TTRAASLGSTPSPSTSLLPSSSSSSASSTGVANLLPPISSSAPVSSRRSPFRTPAVRSNG
LNPVWQTSFLLDIRMPAGHDAKAIVLQRAQRLKHGKERTDDPCVWEDVTRGLLHLCFVQV
QICDEQTSSQVPLATTTLSLGRLRHGYRHVPLYDMQLSPLMYSSLFVHTSYTHMEVLPST
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgccattgtccatgccaccgacgaccgctgacattcaccgacatcaccgacac
cggacgagacccacgacaccaccgacaccaccgacaccaccgacaccaccgacaccaccg
acaccaccgacgccaccgacgccaccgacgccaccgacgctaccgacgccatcgacgccg
ccactagcgacgacttttcgttttcttcctgcgaggtacacggcatggaaagaatcgaca
cgtgctttcaaagccatgcgacacaacagatcggctcagacgactctgccacccgtttgt
gtttcgcctgtaccctctgttgtggcatttgagcctttggatgccatgatacccattacg
atgcgtcagggcgagcgcatgctgaaagtaacgcaaaacaaggtggcgatgcgtttgttc
cgcgtcgacactgagtcggcatcgatcgtgtgggaaagcaagcgagggaattctgtgcgt
ctgtatgcggtgcgcgatgtgcgtgttggcgaatctgcgcgctcataccgtcactcgttg
cagatttctgacgagcatgagccacgctggatctcgatcatctaccagacggcgcgggct
tacaaggctgtacacatggtggcgttatctgatgaatcactcgctagatggcgcgattcg
ctcctgcgcattcttgcgcaatggcatgcgcttgtatcagggcgcgtgacagcatcgcgt
gcacagggtgaatggctccaggcgtcctgggatgtagagaagcgacttgatcagagcgcg
cttgcgcggctgtgtcagcggatgggtgtgcagatcagtcggcccgagcttgacacactg
tttctggaggctgatcgggagcgtgtaggagcgctgaactttgaggcattccagcgtttc
gtcgctgcactgaagcggcgaccagacgttgagcagctgttttaccagctggccaagagg
gatgcgcaagagtcctgttcgatttcgcttagctcattcacctcgttcctgcatcgtgag
cagggcgagtggaagtggacatccgacgatattgcccacatctatcaacgctaccgggtc
gacaccctggatgggtttgcggcgtttctcatgtcgcgagacaatggcgcgtacaatgat
cccgttttgtctggaggcgaagcggcaggaaaagagaaggaaagtggaagccttcatgcg
aggactcaagcatcgagcggccgactggatgagccattaagcagctattatatatcgtca
agtcataacacatacctggagggcgggcaatggaaaggcgatagcactgtcgaaggctat
gtacgtgcactgcataaaggcgcccggtgcgttgagctcgactgctgggacgggcctggc
ggacagccacaggtcacacatggacatacactcaccagtcgcgtgcccttggacgatgtg
gtggcggccgtggcacaatatgcgtttgtcgcttcgccgtacccactgattctttcgttg
gaagtgcataatgatcttgcacagcaagttgttctggccaacattttgcaggcgcggctg
ggcgacatgcttgtgacggcgccattggacgacgatgtccagccagggatgctaccaagt
cctgaacagcttcgcttccgcatccttgtcaagtgcaaggaccatgtttggattcattct
caagtttcacaagatgcggacgaccagcagccgctgccccaggggcgtagctcctcctcg
actgaacagacggaatgggaaagcgattcatttttggatcaagcgcggaatcttgtacgt
ctcgcgcgacatcgcaccgagcgagggaaaatcgctcggcctctcgctcgtgagcttgtg
cgccttctcgtgtataccgtcggcgtgccattccgcggactcaacaagaaagaacagtat
gctgctgagcatatgttctctctatccgagcgctctgcggcgcggctcatgcggcagagc
catgcagacttggtcaaacacaacctgacgcatttgacgcgtgtctatccatcgatgacg
aagctaagccgcctcacgtccagcgcgaatttccttcccatggacatgtgggcatcgggc
tgccagcttgtggctctgaattggcagacacacgaccaaggtatgtcacagaacttggct
cttttcgcgcggagtgccggctatgtccgcaagccgagtgccctgcgtgtgaggagctgc
ttgaagaatgacggcggcacactgcttgtatcgtgcgtgctgaccatcgtgtcggcgcag
caggttccacacatgcggagcgcagacgaggcggtgtgtccgtatgcgacggtaagcgcg
gatgtaccccaacaatggggcaaagatgccgtgcaagtgtctgtaccagcggcggtgccg
agggaatcgccatctatggccacgtgtcaaggcgactccctcgcaggctgtacggcttca
gggcttgccgcgtctggtgctggaagtcgaaccagatctacaggctcaggatcaggatct
accacaagagcggcttcgttgggctcgacacccagtccctcgacgtcgttgttaccgtcg
tcttcgagctcgtctgcctctagcacaggcgttgccaacctgcttccacccatctcatca
tcggcaccggtatcatcacgccgcagtcctttccgcacgccggccgtgcgatcgaatgga
cttaatcccgtgtggcaaacttcgtttttgctagacatacgtatgccagcaggacacgat
gccaaagcgatcgtcctgcaacgagcgcagcggcttaagcatggcaaggaacgaacagac
gatccatgcgtgtgggaagacgtgactcgtggactcttacatttgtgcttcgttcaagtg
caaatttgtgatgagcagacaagcagccaagtaccactcgcaacgacgacgctaagtctc
ggccgtctccggcatggctaccgacatgtcccgctgtatgacatgcagctttcgccgctc
atgtattcctctttgttcgtgcacacatcctatacccatatggaggtccttccctcgacg
tag

DBGET integrated database retrieval system