KEGG   Malassezia globosa: MGL_2587Help
Entry
MGL_2587          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGL_2587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MHVVLAAPVAVRRNQAPREPLAFSPTADVLAVASWDTFVRIYRIDKTNAQPVQPHQQYQH
EGPVLDVCFNADGSKVISVGADKVARCFDLNTNQAAIVAQHNDTIRCVRWLRAFGGALVT
GSWDKTVKIWKIEPQPTLITSLDLPERVYAMDVIGLIVIVAMAERKIMAFQCNEATGTAQ
QVVDQFSPLKYQTRSIAALPDGDGFALGGTEGRVAVHYFHDPPDPKDGKVKKFAFRCHRR
TNADHPDVPRNETQLYPVNAIAFNAQGTFATGGGDGSISFWCKASRTRLKTFETKGAAMA
PKELFKTNPNRLPVTAITFNADASIFAYALGYDWHKGYQGATSETHVFIHPVNPEDIKKR
PPKI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcgtgttggctgcaccggtcgctgtgcgacgaaaccaagcaccaagagagcca
ttggcattttcgccaacggctgatgtgcttgccgttgcaagttgggatacattcgtacgg
atttatcgcattgacaagacaaatgcccagccggtgcagccacatcagcaataccagcat
gagggccccgtgctggatgtgtgcttcaatgctgacggtagtaaagtgatatctgtcggt
gctgataaagtcgctcgttgttttgatctgaatacgaatcaggcagcaatagttgctcaa
cacaatgatacaattcgttgtgtgcgctggcttcgtgcatttggtggggctctcgtgaca
ggcagttgggacaagacagtgaaaatttggaaaattgagccacagcctactcttattacg
tcattagatcttccggagcgcgtatatgctatggacgtgattggattgattgtcatcgtc
gcaatggctgaacgaaagattatggcgttccaatgtaatgaagctacgggtacggcgcag
caagttgttgatcagtttagcccgctaaagtatcaaacacgctccattgccgcgctacct
gatggtgatgggtttgctcttggaggcacagaaggtcgcgttgctgttcactacttccat
gatccaccggacccgaaagacggtaaagttaaaaagtttgctttccgttgtcatcgaagg
accaatgccgaccatcctgatgttcctcggaatgaaactcaactgtaccctgtgaatgcg
attgctttcaatgcacaaggaacctttgcgacagggggtggtgatggctcaattagtttc
tggtgtaaagcgagccgcacaaggttgaaaacctttgaaaccaagggtgcagccatggcg
cctaaggaattatttaaaacgaaccctaaccgtttgcctgtcaccgccattacgtttaat
gcagatgcatccatttttgcttatgcactgggctacgactggcacaagggctatcagggc
gctacgagcgagacgcatgtatttattcacccagtcaaccctgaagatatcaagaagcgg
cctcctaaaatatga

DBGET integrated database retrieval system