KEGG   Malassezia globosa: MGL_2629Help
Entry
MGL_2629          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGL_2629
Peptidases [BR:mgl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGL_2629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MTWSPQSLDPLRFFPPLTQPAPPLDTHASTSALQLTLSDKKRFYVGLSNPSIDCYFNSVV
QSLASLVHLAQYLDDVTVMSRRWHVATPVTDALRSLLVLLNTPQSHRMTVAPRDLRRALQ
HRASHSQGIRTLLSAQQQQDAHELCVLLVEALDAELGTVQQARSDALRAACVGLQVLTAP
SHIVHGRLRTQLGFDGDHSSNPFRGTLAQRTSCGQCGYMEAIRHFSFTDIDLVVPGAACT
LEYCLSAWMQLEGIEWVCHRCSLLATMKRIELERIARDAQAIDHRQSARQLKKIRLLDAQ
LDRVAKVIRSGVHESELEASHALDGIVQERVLSTSATKQIMLAKAPRILLLHVNRSSFSL
GQFGASKNHARVLFSERLNLAPFITGSSLSSHPMKRLSTSHTPTWYVLRAIVTHYGTHNY
GHYVSYRRRPNGVWTRVSDENVQLCAWDDVQAQNPYLLMYERVDGYDDNGCSESVNDIGN
PHGGDHGEPRIFHSAPRTMIPPLHKTHLQPRTLHRWDAYAFLSRNHATPAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacctggtcgccacaaagtctggatccacttcgcttcttccctcccctgacgcagcca
gcgccaccactcgatacgcatgcaagcacctcggctctccaactgactttgtctgacaag
aagcgcttctacgttggtttgtcgaatcccagcatagattgctactttaacagtgttgta
cagagtctcgcaagtctcgtacaccttgcgcagtaccttgacgacgtcactgtcatgtca
cgtcgatggcatgttgccacgcccgtaactgatgccctacgctctcttctcgtcttgctg
aacacgccacagtcgcatcgcatgacagtcgcaccacgcgaccttcgccgagccctacaa
catcgcgcttctcactctcaaggtattcgcacactcctctctgctcagcagcagcaagat
gcacacgagctttgtgttttgctcgtcgaagcgcttgatgccgaacttggcactgttcaa
caagctcgctcagatgcattgcgtgcagcatgcgtggggttgcaagtgctcacggccccg
tcacatattgtacatggccgcttgcggacgcaacttgggtttgatggtgaccacagctcg
aatcctttccgtggcactctcgcacaacgtacttcgtgtggccagtgtggctatatggaa
gctatccgccatttctcctttaccgacattgacctcgtggtaccaggcgccgcgtgcacg
ctggagtactgcctcagtgcttggatgcagctcgagggcattgaatgggtttgtcatcgg
tgcagtcttctagcgacaatgaagcgcatcgagctcgagcggattgctagggatgctcag
gccatcgatcaccgtcagtcagctcggcagctgaagaagatacgtcttcttgatgcacag
ctcgacagagttgcgaaggtgattcgcagcggtgtgcatgagtcagagctagaggcatcc
catgctctggacggtatcgtgcaggagcgcgtgctgagtacgtctgcgacgaagcaaatc
atgctcgcaaaagccccacggatcctgcttcttcacgtcaaccgctcgtctttctctctc
ggtcaattcggcgctagcaagaatcacgcacgagtcctgttttctgaacgtctgaattta
gctccgtttattacagggtcgtcactttcgtcccatcccatgaaacgcttgtctacatcg
catacgccgacatggtacgtgcttcgtgctatcgtgacgcactacggcacacacaactat
ggtcattacgtgtcatatcgacggcgtcctaatggtgtatggacacgagtatcggatgaa
aacgtacagctatgcgcgtgggacgatgtgcaagctcagaatccctacttgctcatgtac
gagcgcgttgacggttacgacgacaacgggtgctctgagtccgtcaatgatattggcaat
ccccatggaggcgaccatggcgagccccgcatattccattcagcaccgcgcaccatgata
ccccccctacacaagacgcacttgcagccgcgtacgctgcatcgctgggatgcttatgca
ttcttgtcacgaaaccacgcaactccagccgcgtag

DBGET integrated database retrieval system