KEGG   Malassezia globosa: MGL_2731Help
Entry
MGL_2731          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mgl  Malassezia globosa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MGL_2731
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MGL_2731
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   MGL_2731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 489 aa AA seqDB search
MSVVSDKPQHRIEASVLSQTFWIDPAYKIKKGLGQGAYGCVASAVHVASGESIAIKKVSN
VFNKRILTKRALRELKLLRHFRGHKNITCLYDLDITNPSAFNEVYLYEELMEADLHAIIR
SGQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLSRGFDP
EQNTVMSGQQEFMTEYVATRWYRAPEIMLSHQNYTTAIDLWSVGCILAELLGRRPLFKGH
DYVDQLNQILYYIGTPPEPMLCRVASPRAQQYIRSLPYKKPVPFEHLYPEATPLALDMLR
RLLSFDPEQRITCDEALEHPYLAVWHDPNDEPVCANKFDFSFEQVDDIDGMKKLILQEVI
SFRREVRLQAQQRLAMMEQHQQQQQLQQQFYANQMGSSSASSSASSAEAIRRREEAQVAA
SRGTIQKSSSEHATYNILGEPMSADGTPKDVGDVAVAENDAAEYPYGAYMLADFDSDAFS
RQLNQHHVS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgtgagtgataagccacaacaccgcatagaagcttctgtgctgtcacaaacc
ttttggattgatcctgcgtacaaaattaagaagggactcggtcaaggcgcatatggatgt
gtggcttcagctgtacacgttgcttctggcgaaagcattgcgataaagaaggtatcgaat
gtatttaacaagcggattcttacgaagcgtgctcttcgtgaacttaagctcttgcgccat
ttccgggggcataaaaatattacgtgcttgtacgatctggacatcactaatccgtctgcc
tttaatgaggtgtacttgtacgaggagcttatggaggctgatcttcatgcgattattcga
tcgggacagccgctgagtgatgcgcacttccagagcttcatttaccaaaccctatgtggt
ttgaagtacattcacagtgcaaatgtgctgcaccgtgatctgaagccgggcaatctgctt
gtcaatgcagattgtgagctaaagatttgtgactttggcttgtcgcgtggcttcgaccca
gagcaaaacaccgttatgtcaggccagcaggaatttatgacagagtatgtcgccacgcga
tggtaccgagcaccggagatcatgttatcacaccagaactatacgacggcgattgatcta
tggtctgtcggctgcattctcgctgagcttctaggtcgacgcccactcttcaagggccat
gattatgtcgatcagctgaaccaaattttgtactatattggaacgcctccggagcccatg
ttgtgccgtgtagctagtcctcgtgcgcaacagtacattcgctcattaccgtacaagaag
cctgtgcctttcgagcatttatacccggaggcaacaccgcttgcactcgacatgcttcgc
cgcctgctttcctttgatcctgagcaacgtatcacttgtgacgaagctttggagcatccg
tacctggctgtttggcatgatccgaatgatgagccagtgtgtgcgaacaagtttgacttt
agttttgagcaagtcgatgatattgatggtatgaagaagctcattcttcaggaagtaatc
agctttcgtcgcgaagtccgcttgcaagctcaacagcgcctggccatgatggagcagcac
caacaacagcaacagctacaacagcaattttacgcgaaccaaatgggttctagctcggca
tcgtcctctgcctctagtgctgaggccatccgccgtcgtgaagaggcacaagtagcggca
tcacgcggaacgatccaaaagtcttcaagcgagcacgctacctacaatatcctaggtgag
cctatgagtgcggatggtacgccaaaggatgttggtgacgttgccgtggctgaaaatgac
gcagccgaatatccttatggtgcgtacatgcttgctgacttcgactcagatgcatttagc
cgtcaattgaaccagcaccatgtgtcgtaa

DBGET integrated database retrieval system