KEGG   Malassezia globosa: MGL_2762Help
Entry
MGL_2762          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
mgl  Malassezia globosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MSTKLSGTSRLPQDILTTKLSSMTMQEHESHLRVFVSSRVLSLDEPEPALSDIHAHASEP
ASYSTQTDYMPDPETLSIPDIHLARLSLLATKAPHNPPGSLPRSTPSDHLSDATSSDGEG
DERMHASEIPDTLPQGDLYLCGPHESEVRDTQDGGSREAIGHALGACVEAVDRVVAAASV
ADRIGTEIPRESPYLTSQQLFPIQAGLSDIPPSRWTEHTPAKRAFVLSRPPGHHCSGADP
SGFCWVNNAMVAAAHAYRAHSIDRVVILDIDLHHGNGTQALAWRRNADAAASDSQRQARL
QSMMRSMQRTGSAASRQAARVADATRTRWERLLHEESLVGPRAQRLFYGSLHDIESFPCE
NGDAELIRNASVCLGGAHGQWIWNGTYENACATG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaactgtcagggacttcgcgtttgccacaggacatactcaccaccaaactc
tcaagtatgacaatgcaggagcacgagagtcatttgcgtgtgtttgtttcgtcgcgagtt
ttaagcctagatgagccagagcccgctttgagtgatattcatgcccatgctagtgagcca
gcctcatattcgacgcagacagactatatgccggatccagaaactctcagtatccccgac
atccatctagcgcggctgtctttattagcaacaaaggcgccccacaatccgccaggatcc
ttacctcgctcaacaccctcagaccatctttcagatgctacatccagcgatggcgaaggt
gatgagcgtatgcatgcctcagaaatacctgatacattaccgcaaggtgatttgtatttg
tgtggtccgcatgagagcgaggtgagagacacacaggatggtggctcaagagaagctatt
gggcatgcactgggtgcatgcgtagaggcagttgaccgcgtcgttgctgcagcttccgtt
gcagataggatcgggactgaaattccgcgcgagtctccgtatctgacatcgcaacagctc
ttccctattcaggcaggtttgtccgatataccccccagtcgatggacagaacacacgcca
gccaaacgggcgtttgtcttatcgcgaccgccgggacatcactgtagtggcgctgatccc
tccggtttctgttgggtgaacaatgcgatggtggcagcagcacatgcgtatcgtgcacat
tcaatcgaccgcgtggtgattctagatattgacctgcaccatggaaatggcacgcaagcc
ttggcttggcgaagaaatgccgatgctgccgcgtcagactcccagcgacaagcacggctt
caatctatgatgcgaagtatgcagcggactggttccgccgcatcgcgacaagcagcgcgg
gtggcagatgctactcgcacgcgttgggaacgattgctgcacgaagagtcactcgtcgga
ccacgtgctcagcgtcttttttacggaagtcttcacgatattgagagcttcccatgtgag
aatggggatgccgagctgatccgtaatgcaagtgtatgccttggaggagctcatggacaa
tggatttggaatggtacgtatgagaatgcatgcgcgacaggctag

DBGET integrated database retrieval system