KEGG   Malassezia globosa: MGL_2823Help
Entry
MGL_2823          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
mgl  Malassezia globosa
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 540 aa AA seqDB search
MSGVFMLQNASPEVARARLLSFFTPSSVLSGPLVTPPPSAIETVTPAWSKPRIWSQHATA
SVCPKNKSALVIHSPAISISTTGTEATTSPQTHIEGPSYTSTSHLGYATQPPASIEELYS
NAHECMHAPLTVPVGLVNQGNSCFASAVLQMLVFCRPLYMFLTQLRMMVPQDLSNSTPLL
EAIFRFYSEIPVVSKQLYGLVEKSVDPILPDYIYDAMRLHKRFDLFQLGHQEDAEEFLSL
ILSTLHEEVVLVFARAMQRKKSSASLQQRAPKKSVAMGDPYAAYPPPMESDNSSDEEDIL
AMEVQRPPSPEQDEWLEVGQKGRTSLTRTSGNTDTHSPVTRMFDGKLRSTLSCPGAKTSV
MVEPYRSLPLDIQSSHVHTIEDALRHITEPELISGVWSPQRNAYVDATKQVRIEALPPVL
VLHLKRFVFDEFYGVQKSTKPIHFGMSLEISPDILSTPCRRACSLTKYALFGVVYHHGRL
ASGGHYTVAVRRQDDSGWIHIDDTYASQISAEEVMFTGHRSSTHNGQAYLLFYQKVPPIM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagtctttatgctacaaaatgctagccccgaagttgctcgtgcgcggttgttg
tcgtttttcacaccatcatctgttctctctgggcctttggtcacgccgccaccgtcagca
atagaaacagtgacacctgcatggtcgaagcctcgaatttggtcgcaacatgcgaccgca
tccgtatgccctaagaataagtctgcattggtgatccactcgccggctatatctatatcc
actacgggaacagaggcgacaacatcacctcaaactcatatcgaaggtccttcttataca
tctacgtcgcacttgggttatgcaactcaaccgcctgcttcgattgaggaattatactca
aatgcacacgagtgtatgcatgcccctttgaccgttcctgtgggtctagtgaatcaggga
aactcttgttttgccagtgccgtacttcagatgcttgttttctgtcgaccattgtatatg
tttttaacgcaattgcgcatgatggtaccccaagatctaagtaattccacgccgctcctt
gaggctatctttcgcttttattctgaaatacctgtcgtatcgaaacagttgtatggtcta
gttgaaaagagcgttgatccgattttgcccgattacatctatgatgcgatgcgactgcat
aaacgctttgatttgtttcaacttggtcaccaggaagatgccgaagagtttcttagtctc
atcctcagcaccctgcacgaagaagttgtccttgtgtttgctcgggcaatgcaacgaaaa
aagtcatcggcatcgttgcagcagcgagcgccgaaaaaatcagtcgccatgggtgatcca
tacgcagcttacccgccgcctatggagtcagacaattcgagcgatgaggaagacattctt
gcaatggaagttcagcggccacctagtcccgagcaagatgaatggctagaggttggtcag
aaaggcaggaccagtcttactcgtaccagtggtaatactgacacacattcaccggtgaca
cgcatgttcgatggcaaactgcgcagcacattgtcttgcccaggagcgaagacaagtgtc
atggttgagccttatcgctcattgccattggacatccaatcctctcatgtgcacactatt
gaagatgcgttacgtcatattacggagcctgagttgatatctggtgtatggtctccacag
cggaatgcgtatgttgacgcaacaaaacaggtgcgcatcgaggcactgcctcccgtcttg
gttctgcatctgaagagatttgtatttgatgaattttatggtgttcaaaagagcacgaag
ccaatccattttggcatgtcactagaaatctcacctgacattttaagcacaccctgtcga
agagcgtgttcattgacaaagtatgcgctattcggcgttgtgtatcatcatggacgcctc
gcctccggcggtcattacactgtcgcagtgcgacgccaagacgattcaggttggattcac
attgacgatacctatgcatcgcagatatctgcagaggaagtaatgttcacgggccatagg
tcctccacacacaatggccaggcgtacttgctcttctatcaaaaagtccctccgatcatg
tga

DBGET integrated database retrieval system