KEGG   Malassezia globosa: MGL_2823Help
Entry
MGL_2823          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
mgl  Malassezia globosa
Pathway
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    MGL_2823
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGL_2823
Peptidases [BR:mgl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGL_2823
Ubiquitin system [BR:mgl04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    MGL_2823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 540 aa AA seqDB search
MSGVFMLQNASPEVARARLLSFFTPSSVLSGPLVTPPPSAIETVTPAWSKPRIWSQHATA
SVCPKNKSALVIHSPAISISTTGTEATTSPQTHIEGPSYTSTSHLGYATQPPASIEELYS
NAHECMHAPLTVPVGLVNQGNSCFASAVLQMLVFCRPLYMFLTQLRMMVPQDLSNSTPLL
EAIFRFYSEIPVVSKQLYGLVEKSVDPILPDYIYDAMRLHKRFDLFQLGHQEDAEEFLSL
ILSTLHEEVVLVFARAMQRKKSSASLQQRAPKKSVAMGDPYAAYPPPMESDNSSDEEDIL
AMEVQRPPSPEQDEWLEVGQKGRTSLTRTSGNTDTHSPVTRMFDGKLRSTLSCPGAKTSV
MVEPYRSLPLDIQSSHVHTIEDALRHITEPELISGVWSPQRNAYVDATKQVRIEALPPVL
VLHLKRFVFDEFYGVQKSTKPIHFGMSLEISPDILSTPCRRACSLTKYALFGVVYHHGRL
ASGGHYTVAVRRQDDSGWIHIDDTYASQISAEEVMFTGHRSSTHNGQAYLLFYQKVPPIM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagtctttatgctacaaaatgctagccccgaagttgctcgtgcgcggttgttg
tcgtttttcacaccatcatctgttctctctgggcctttggtcacgccgccaccgtcagca
atagaaacagtgacacctgcatggtcgaagcctcgaatttggtcgcaacatgcgaccgca
tccgtatgccctaagaataagtctgcattggtgatccactcgccggctatatctatatcc
actacgggaacagaggcgacaacatcacctcaaactcatatcgaaggtccttcttataca
tctacgtcgcacttgggttatgcaactcaaccgcctgcttcgattgaggaattatactca
aatgcacacgagtgtatgcatgcccctttgaccgttcctgtgggtctagtgaatcaggga
aactcttgttttgccagtgccgtacttcagatgcttgttttctgtcgaccattgtatatg
tttttaacgcaattgcgcatgatggtaccccaagatctaagtaattccacgccgctcctt
gaggctatctttcgcttttattctgaaatacctgtcgtatcgaaacagttgtatggtcta
gttgaaaagagcgttgatccgattttgcccgattacatctatgatgcgatgcgactgcat
aaacgctttgatttgtttcaacttggtcaccaggaagatgccgaagagtttcttagtctc
atcctcagcaccctgcacgaagaagttgtccttgtgtttgctcgggcaatgcaacgaaaa
aagtcatcggcatcgttgcagcagcgagcgccgaaaaaatcagtcgccatgggtgatcca
tacgcagcttacccgccgcctatggagtcagacaattcgagcgatgaggaagacattctt
gcaatggaagttcagcggccacctagtcccgagcaagatgaatggctagaggttggtcag
aaaggcaggaccagtcttactcgtaccagtggtaatactgacacacattcaccggtgaca
cgcatgttcgatggcaaactgcgcagcacattgtcttgcccaggagcgaagacaagtgtc
atggttgagccttatcgctcattgccattggacatccaatcctctcatgtgcacactatt
gaagatgcgttacgtcatattacggagcctgagttgatatctggtgtatggtctccacag
cggaatgcgtatgttgacgcaacaaaacaggtgcgcatcgaggcactgcctcccgtcttg
gttctgcatctgaagagatttgtatttgatgaattttatggtgttcaaaagagcacgaag
ccaatccattttggcatgtcactagaaatctcacctgacattttaagcacaccctgtcga
agagcgtgttcattgacaaagtatgcgctattcggcgttgtgtatcatcatggacgcctc
gcctccggcggtcattacactgtcgcagtgcgacgccaagacgattcaggttggattcac
attgacgatacctatgcatcgcagatatctgcagaggaagtaatgttcacgggccatagg
tcctccacacacaatggccaggcgtacttgctcttctatcaaaaagtccctccgatcatg
tga

DBGET integrated database retrieval system