KEGG   Malassezia globosa: MGL_2833Help
Entry
MGL_2833          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     MGL_2833
Protein kinases [BR:mgl01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   MGL_2833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 MASE1
Motif
Other DBs
NCBI-GeneID: 5854154
NCBI-ProteinID: XP_001729847
UniProt: A8Q5Z3
AA seq 464 aa AA seqDB search
MHRAYHISAKLWSQINRFAAFPPTGVSLRQMVIFGRNANPGTLLLASSFLMEELPVRFAH
RVKDLQELPGNLSDMPSIIKVKNWYAQSFDELVSFPQPHLPDSLQRKLLKSTVSDTLEPA
PATPNPSLEENALLDDGVSKTHLIANSKRAEHSPMRRRPTLNYGTQTRLDGIDWPADVIE
FNNRFTRCLERIKHRHDGVVTTIAQGVLEYKRAKKNSTNQADLQVFLDRFYMSRIGIRML
IGQHIALGRACMAPKKSALNYLSAQATKGALSDVSGSEPEEYVGVICTNTNVGAVAHEAI
ENSRFVCEEHYGLFRAPPVQLVCPKNLTFMYVPSHLNHMLFELLKNSLRAVVERYGVENE
DHFPPIKVIVVEGKEDITIKISDEGGGIPRSEVPQAWTYMYTTARSEDLDPDFHSSDFQA
PMAGFGYGLPLARLYARYFGGDLRLISMEGACMCLFMLACATRV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcatagggcgtaccacatatcagcgaagctatggtcgcaaattaatcggtttgcagca
ttcccaccgacaggtgtgtcgcttcgacaaatggtgattttcgggcggaatgccaatcct
ggaaccctgttgctcgcaagctcgttcttgatggaggaattgcctgtgcgattcgcgcat
cgagtgaaggatttacaggagctacctggaaatttgtctgatatgccatccatcatcaag
gtcaagaactggtacgcgcagtcatttgatgaactcgtgtcgttccctcagccacacttg
cctgactcgcttcaacggaagctactcaagtcgactgtgtcggacacgctggaaccagcg
ccagcgacacccaacccaagtctggaggaaaacgcgttgttggatgacggtgtatcgaaa
actcatctgattgcgaatagcaaacgggcggagcattcgccaatgcggcgacggccaaca
ctgaactatgggacgcagacccggctggatggcattgactggccagcggatgtgattgag
ttcaacaaccgatttacgcggtgtctcgagcgtatcaagcaccggcacgacggcgtagtc
acgacgattgcacaaggtgtactggagtacaagcgtgcaaagaagaatagcacgaatcaa
gcagatttacaagtgttcttggaccgtttctacatgtctcgcataggtattcgcatgctg
attggacaacacattgcgttgggccgtgcgtgtatggcacccaagaaaagtgcgctcaat
tatctctctgcgcaagcgacaaaaggcgcattgagtgatgtgagtgggagcgagcctgag
gagtatgtcggagtaatttgcacaaacacgaatgtcggggctgtggcgcatgaagctatt
gagaattcgcgcttcgtgtgtgaagagcattatggcttgttccgtgcacccccagtccag
cttgtatgtccaaagaacttgacattcatgtacgtgccaagtcacttgaaccacatgctg
tttgagctgctgaaaaattcgctgcgtgcggtggtagaacgatacggcgttgaaaatgag
gaccatttcccaccgatcaaggtgattgtcgttgagggcaaagaggatatcacgatcaag
atcagcgacgaaggtggtggcattccccgcagtgaagtcccgcaggcgtggacgtatatg
tataccaccgcgcgttcggaagacttggacccagatttccattcgtccgacttccaggcg
cccatggctggctttggttacggtcttccgctggctcgtttgtatgcacgctattttggc
ggcgatctacgactgatctcgatggaaggcgcttgcatgtgtttgttcatgcttgcttgc
gctacccgtgtttga

DBGET integrated database retrieval system