KEGG   Malassezia globosa: MGL_2847Help
Entry
MGL_2847          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mgl  Malassezia globosa
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:mgl04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
MLEAVQFIHEKGNLVHTDLKPANFLLAKGRLKLIDFGIAQKIPIGTIHISRDAIVGTPNY
MAPEAIKIAKAHGRRVYKAGKASDVWSLGCILYQMVYGRPPFDRFMGEKKLETIMDPQHH
IPFPPHRVLDDPSSERVDPPMLEALTSTLHYDAQQRARIPALLESELLNDHLHETVTLTR
KTLRALVARLRLHSVQGELNEDNVIQCTDVRMREPCTLCFSESLSYFTNMLGPI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagctgtgcagttcattcacgagaagggcaatctcgttcacacggatctgaag
ccggcgaactttctcctagccaaaggacgacttaaactgatcgattttggcattgcacag
aaaatcccgattgggacaatccacatttctcgcgacgccattgttggaactcctaattat
atggcaccagaagcgatcaagattgccaaggcacacggccgtcgtgtgtataaagcgggg
aaagctagtgatgtgtggtcactagggtgtattctataccagatggtgtatgggcggccg
ccctttgatcgcttcatgggcgagaagaaactcgagacaatcatggatccacaacaccac
attccattccccccacaccgtgtgctggatgatccttcgtcagagcgtgtggatccaccc
atgctagaggcactgacatccacgcttcattacgatgcacaacaacgagcaaggatccct
gcacttttggaaagcgagcttctgaacgaccacttgcatgaaactgtaactcttactcga
aagacgttgcgcgcacttgtagcacgccttcgactacactcggttcagggcgagctgaac
gaagacaatgtgattcagtgcacagacgtacgtatgagggagccatgcactctttgcttt
agcgagtcgttgtcttattttactaacatgctaggacctatttga

DBGET integrated database retrieval system