KEGG   Malassezia globosa: MGL_2847Help
Entry
MGL_2847          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mgl  Malassezia globosa
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    MGL_2847
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     MGL_2847
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: Other group
  TTK family
   MGL_2847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
MLEAVQFIHEKGNLVHTDLKPANFLLAKGRLKLIDFGIAQKIPIGTIHISRDAIVGTPNY
MAPEAIKIAKAHGRRVYKAGKASDVWSLGCILYQMVYGRPPFDRFMGEKKLETIMDPQHH
IPFPPHRVLDDPSSERVDPPMLEALTSTLHYDAQQRARIPALLESELLNDHLHETVTLTR
KTLRALVARLRLHSVQGELNEDNVIQCTDVRMREPCTLCFSESLSYFTNMLGPI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagctgtgcagttcattcacgagaagggcaatctcgttcacacggatctgaag
ccggcgaactttctcctagccaaaggacgacttaaactgatcgattttggcattgcacag
aaaatcccgattgggacaatccacatttctcgcgacgccattgttggaactcctaattat
atggcaccagaagcgatcaagattgccaaggcacacggccgtcgtgtgtataaagcgggg
aaagctagtgatgtgtggtcactagggtgtattctataccagatggtgtatgggcggccg
ccctttgatcgcttcatgggcgagaagaaactcgagacaatcatggatccacaacaccac
attccattccccccacaccgtgtgctggatgatccttcgtcagagcgtgtggatccaccc
atgctagaggcactgacatccacgcttcattacgatgcacaacaacgagcaaggatccct
gcacttttggaaagcgagcttctgaacgaccacttgcatgaaactgtaactcttactcga
aagacgttgcgcgcacttgtagcacgccttcgactacactcggttcagggcgagctgaac
gaagacaatgtgattcagtgcacagacgtacgtatgagggagccatgcactctttgcttt
agcgagtcgttgtcttattttactaacatgctaggacctatttga

DBGET integrated database retrieval system