KEGG   Malassezia globosa: MGL_2920Help
Entry
MGL_2920          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mgl  Malassezia globosa
Brite
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   MGL_2920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2300 aa AA seqDB search
MLSELKGERLQAFSNELNRRVIELTHSAQTASKLGGITAIDNFIGLESEDNSARLYRFYQ
YLKPNLPCSDPQVMFAAARVLGRVSKHGGHSLGDQFVEFEMQRALDFLQGERNENGRYAA
VLIIKEMARNVPYLFHTYVGRVMDHIWVALRDAKVAVREAAAEALGACFQIISDREKQMG
TQAYELVYDDAEQGLRDTAVEVIHGSLLAILKLLRYSKMFMKTRLHRTCELILRLHRHRD
PLVKRTVTNLIPVLAAYDPPYYAQEYLGPVMTTLIDQLRRERDRSTKEAWGDTLEAIGLV
SMAMGDRMQPYVDSIMQCVRESLLLRGKKNMPPEGPVFFCLGHVALAVGTRIERDVHDML
DMMFACGLSTALVSALEKIVHAIPALLPIVQERLLMMLSYILIGVPYRPLGAPLPRHGGR
PPPVLHVSPDAKTIETLTIALQTLGSFDFSGHILNEFVRNCTLPYLELDAKDVRKAAAMT
CAHMYVNDPICYQTSMHAIEVFNDVLDKLIMVGIADPDAELRFTVLSALDEHFDRHLAQT
EYIRAIFIALNDEEFAVREVAINILGRLAKYNPAYVMPSLRKVLIQLLTGLEYATVTRHK
EEAAKLLTGVVRALQGLVKSYALTILQVLLPKANDAHAGVAARVTECLGELARVAGEELA
PLVDELVSLMVSQLSSGSVHASVAKRDAALKTLGRLASNTSHVANPYLQYPRLLGALVKI
LKTEQAAPVRRETIRVLGILGALDPYRHKLLESTMDPVVTAGGSQTDLFELATLIGTSTD
EYYQNVAIEALIAILRDPTLSVHHHAVIEAIMYMFKTQGLKCVAFLPQIVPAFLGVIRTC
AGGGLSEFYYQQLAILITIIKQHVRNYLRDIFALVQADWNPNSSIQLTIVALMEAVARAL
EGEFKAYLPLLLPNLLQTLEGEITPKRMPTLLRMLQAFYVFGANLEEYMHLVLPVLVGLF
ERADAPMVLRRAAIVTVGQLSRKVNFADHASRIIHPLVRVLQSGVAELRVPTLDTLTALV
FLMGPVYMPFVVVVNKAIVQQRIQHPRYQQVVAKLLRSEPLPLELLPPDTLALDKADEAP
HAEASKMAVNQLHLKAAWDTSRVSTAQDWREWLRRVAVEMLRESPSHALRACRSLAEVYH
PLALELFNAAFVSCWVELYDTYQESLVHAIETALDAYEIPDQVVHILLHLAEFMEHDDKA
LPISIRLLGDRAYKFHAYAKALHYKEAEFMAEPTPQIVELLIDINTKLQQGDAAFGALTY
AREHMDITHHEEWYEKLHRWEEALAAYERRALEQPDAQEIVFGKMRCLHALGEWEHLTEL
VQAKWPTAGPDGRRQMAPLATAAAWSFGQWDIMDEFIAAMRPESSERSFYRAVLAVHHSQ
RHQTKRLIARARDALDTELTALISESYGRAYDLMVRTQMLSELEEALAYKLDYAEQPDRQ
ATMRTIWMKRLQGCELDVEVWQRILSVRSIVLTPADDMDTWIKFANLCRKSGRMVLAEKT
LNSLLGPEVHALDSPLAGPKAPPAVIYSHLKFMWACGARAESLCYLRDFTMNLAEDLGMA
SVDKQDNLVLPDIRASPRLAEFAKLLARCFFKLGEWQVAMNEEWVVDDNYDVIRSYKRST
ELDRDWYKAWHAWALANFDVITHHERHGVAIPFHEVAASIVPSVHGFFRSISLASGNSLQ
DTLRLLTLWFKFGHLEHVADAVRQGFSTVTVDTWLEVIPQMIARISAPSPRVRRLIHHLL
SDVGTAHPQALVYPLTVATKSPSPVRMHAAMGIMDTMREHSPVLVEQALLVSNELIRIAI
LWHEMWHEGLEEASRLYFTEHNIEGMFATLGPLHDLLERGPETLRETSFAQTHGRDLNEA
REYVRRYRQYGEINDLNQAWDLYYHVFKRITKQLPASNSVQLALQYVSPKLLAMRDLELA
VPGTYVSGQPIVRITQFEPVVLVISSKQRPRRLKIRGSDGRTYQYLLKGHEDMRQDERVM
QLFGLVNTLLSIDTESYKRRLNLRRFPVIPLSPNTGMLGWVANSDTLHILIKEYREQHKI
LLNIEHRLMLQMAPDYDNLTVLQKVEVFEYALDNTPGQDLYRVLWLKSRSSEAWLERRTA
YMRTLATSSVAGYILGLGDRHPSNLLLDRQTGEIIHIDFGDCFEIACHRPKFPEKVPFRL
TRMLIKAMEVGGIQGTFKVTAENTMRVLRDNRESVLALLEAFVHDPLISWRLVTDSDAEQ
RAPDAHEHEHEVAGEIRGVEGEARNQRALEVVRRIQNKLTGRDFHPNISLSVPEQIERLI
QDATSIENLCVAFIGWCAFW
NT seq 6903 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcggagctgaagggagagcggctccaggcgttttcgaatgagctgaaccggcgc
gtcatagagctcacacacagcgcacaaacggcaagcaagctgggtggcattacggcgatt
gacaactttattgggctcgaaagcgaggataatagtgcgcgtctgtatcgcttctaccaa
tatttgaagccgaacttgccttgctctgatccgcaagtcatgtttgctgcagcgcgtgtg
ttgggccgtgtgtcaaagcatggaggacactctctgggagaccaatttgtggaatttgag
atgcagcgtgcactggactttctgcagggtgaaaggaatgagaacggacggtacgcagcc
gtattgatcatcaaggaaatggcacggaatgtgccctacctgttccacacgtacgtgggg
cgcgtcatggaccatatttgggtcgcactgcgggatgcgaaagtagcggtgcgagaggcg
gcggccgaggcactgggtgcgtgcttccagatcatctcagaccgcgagaaacagatgggc
acacaggcgtacgagctcgtatacgacgacgccgaacaagggctgcgcgataccgcggtc
gaagtgatccacgggagtctgctggcgattttgaagttactgcgatactcgaagatgttt
atgaagacgcgtctgcatcgcacatgtgagctgattctgcgacttcaccggcatcgtgat
cctcttgtcaaacgcacggtgacgaacctgattcccgtgctggccgcgtacgatccgcct
tactatgcccaagagtatctgggacctgtgatgacgacgctcattgaccaactgcggcgc
gagcgagatcggtctacgaaggaggcatggggcgatacgctcgaagcgattggactcgtg
tccatggcgatgggcgaccggatgcagccgtacgtcgattcgattatgcagtgtgtgcgt
gagagtttgctgcttcggggtaagaagaatatgccgccagagggaccggtatttttttgc
ttggggcatgtggcgctggctgtcggcacacgcattgagcgggatgtacacgacatgctc
gatatgatgtttgcatgtggcctgagtaccgcgctagtgtcggcgctggagaagattgtc
catgcgattccggcgctgctgccgattgtgcaggagcggctcctgatgatgctgtcgtac
attctcataggcgtgccgtaccggccgcttggtgcgccacttccccggcacggtggccgg
ccgccgcctgtgctgcatgtgtcgccggatgcaaagacgatcgagaccctgacgattgcg
ctgcagacgctcggcagctttgattttagtggacacatactgaacgagttcgtccgcaac
tgcacgctgccgtacctggagctggatgcgaaggacgtacgcaaggcggcagctatgacg
tgtgcccacatgtatgtgaatgatccgatctgctaccagacgtcgatgcacgcgatcgag
gtgtttaatgacgtgctagacaagctcattatggtgggaattgcagatccagatgcagag
ctgcgcttcacggtgctgagtgcactggacgagcactttgatcggcacctcgcacagaca
gagtacatccgagcgatcttcattgcgttgaacgatgaggagtttgccgtgcgagaggtc
gcgatcaacattttgggccgcttggccaagtacaacccagcgtatgtgatgccgtcactt
cgcaaggtgctgatccagctgctgacgggactggagtatgcgaccgtcacacgacacaag
gaggaggcggcgaagctgctgacgggggtcgtgcgtgcgctgcaagggcttgtgaagagc
tatgcgctaacgatcctgcaggtgctgctcccaaaggcgaacgatgcacatgcgggtgtt
gcagcccgcgtgacagagtgcctgggcgagctggcccgagtggctggcgaagagctggcg
ccgctcgtcgatgagctggtatcgctgatggtgtcacagctgtcgagtggctccgtgcat
gcatcggtcgcgaagcgggacgcggcgctcaagacgctgggtcgtctggcgtcgaacacg
agccacgtagccaatccgtacctgcagtacccgcgactgctgggggcgttggtcaagatc
ctcaagacggagcaggcggcgcctgtgcgacgcgagacgatccgcgtcctgggcatactg
ggtgcgctggatccgtaccggcacaagctgctcgagagcacgatggacccggtcgtgacc
gcaggcggctcacagaccgacttgttcgagcttgcgacgctcatcgggacgtcgacggac
gagtactaccagaatgtggcgatcgaggcgctcattgccatcctgcgcgacccgacgctg
tctgtacaccaccatgcggtgatcgaggctatcatgtacatgttcaagacgcagggtctc
aagtgcgtggcgtttctgcctcagattgtgccggcattcctgggcgttatccgcacatgc
gccggcggcggcctgagcgagttctactaccagcagcttgcgatcctgatcaccatcatc
aaacagcacgtgcgcaactacctgcgtgacatttttgcgcttgtgcaggcggactggaac
ccgaattcgtcgatccagctcacgattgtcgcgctgatggaggcagtcgcacgggccctc
gagggcgagttcaaggcgtacctgccgctgctgctgccgaacctgctgcagacgctcgag
ggcgaaatcacaccgaaacgcatgccgacgcttttacgcatgctgcaggccttctatgtg
tttggcgcgaacctggaggagtatatgcaccttgtgctccctgtgctggtcggtctcttt
gagcgcgcggatgcgccgatggtgctgcgccgtgcagcgatcgtcactgtgggccagctg
tcgcgcaaggtgaactttgcggaccatgcatcgcgcatcatccatccgctcgtgcgcgtg
ctacagagcggtgtcgcagagctgcgggtaccgacgctcgatacgctcacggcgctcgtg
ttcttgatgggccctgtgtacatgccgtttgtcgtcgtggtgaacaaggcgatcgtgcag
cagcggatccagcatccgcgctaccagcaggtggtcgcgaagctcctgcgcagtgagccg
ctcccgctcgagctgctcccgcccgatacgcttgccctggacaaggcggacgaggcgccc
catgcggaggcgtccaaaatggcggtgaaccaactccacctgaaagctgcctgggacaca
tcacgtgtctcgaccgcccaggactggcgcgagtggctccggcgcgtcgcggtggaaatg
ctgcgtgagtcgccgtcgcacgcgctgcgtgcgtgccggagcctcgcggaagtatatcac
ccactggcgctcgagctgttcaatgccgcatttgtgtcgtgctgggtcgagctgtacgac
acataccaggagagccttgtacatgcgatcgagaccgccctcgatgcctacgagatcccc
gaccaggttgtgcacatcctcctacacctggccgagttcatggaacacgacgacaaggcg
ctgccaatcagcattcggctgctgggtgaccgcgcgtacaagttccatgcgtacgccaaa
gccctgcactacaaggaggccgagttcatggccgagccgacgccgcagatcgtcgagctg
ctcatcgacatcaacaccaagctgcagcagggtgacgcggcgttcggtgcgctcacgtat
gcgcgcgagcacatggacatcacgcatcacgaggaatggtacgaaaagctgcaccgctgg
gaagaggcgctggcagcgtacgagcgacgtgcactcgagcagccggatgcgcaagagatt
gtattcggcaagatgcgctgcctgcatgcgctgggtgagtgggagcacctgaccgagctc
gtgcaagccaagtggccgacagcggggcccgacggccggcgccaaatggcgcccttggcg
accgcagctgcatggtcgtttggccaatgggacattatggatgaattcatcgcagcgatg
cgccccgagtcgtcggagcgctcgttctaccgcgcggtgctggctgtgcaccactcgcag
cggcaccagacgaagcggctgattgcgcgtgcgcgcgacgcgctggacacggagctgacg
gccctgatcagcgagagctacggacgcgcgtacgaccttatggtgcgcacacagatgcta
tccgagctggaagaggctctagcctacaaactggactatgcggagcagcccgaccgccag
gcaacgatgcggacgatctggatgaagcggctgcagggctgtgagctagatgtggaggtc
tggcaacgcatcctgagtgttcggagcattgtgttgacgcccgccgacgacatggacaca
tggatcaagtttgcgaacttgtgccgcaagtcgggacgcatggtgctcgcagaaaagacg
ctcaactcgctccttgggcccgaggtgcatgcgctggactcgccgctcgccgggccgaaa
gcgccgcccgccgtgatctactcgcacctcaagttcatgtgggcatgcggtgccagagcc
gagagcctgtgctacctgcgcgactttacgatgaacctggccgaagacttgggcatggcc
tccgttgacaagcaggacaacctcgtcctgccagacatccgcgcctcgccgcgcctcgct
gagttcgccaagctgctcgctcgctgcttcttcaagctcggcgaatggcaggtcgcgatg
aacgaggagtgggtcgtcgacgacaactatgacgtcatccgctcgtacaagcgctccacg
gagctcgaccgcgactggtacaaggcatggcatgcatgggcgctcgcgaactttgacgtc
atcacgcaccacgagcgccatggcgtcgcgattcccttccacgaagtcgctgcgagcatc
gtgcccagtgtgcatggcttcttccgctccatctcactcgcgagcggcaactccctccaa
gacacgctccgcttgctcaccctctggttcaagtttggtcatctcgagcatgtcgctgat
gccgtgcgtcagggtttcagcaccgtcaccgtggacacgtggctcgaggtcatccctcag
atgatcgctcgcatcagtgctccgtcgccgcgggtgcggcgcctcatccaccacctgctc
tccgacgtcggcacagcgcatccacaggccctcgtgtatccgctaacggtcgcgaccaag
tcgccgtcgcctgtgcgcatgcatgccgctatgggcatcatggacacgatgcgtgagcac
agtcccgtacttgtggagcaagcgctgctggtcagcaacgagctcatccgcatcgcgatc
ctctggcatgagatgtggcacgagggactcgaagaagcgtcgcgtctctactttaccgag
cataatatcgagggcatgtttgcgacgctggggccactgcacgatctgcttgagcgcggg
cccgagacgctgcgtgagacatcgttcgctcagacccacggacgcgatctgaacgaggca
cgcgagtacgtccggcggtaccggcagtacggcgagatcaacgacttaaaccaggcctgg
gatctgtactaccacgtgttcaagcgcatcaccaagcagctgcctgcgtccaactccgtg
cagctggctctccagtatgtatcgcccaagctgcttgccatgcgcgacttggagctcgcc
gtgcccggcacgtacgtgagtggccagccgatcgttcgcatcacacagttcgagcctgtc
gtgctggtcatctcgtcgaagcagcggccgcgccggctcaagatccgcggcagcgacggg
cgcacgtaccagtacttgctcaagggccacgaggacatgcggcaggacgagcgcgtaatg
cagctgtttggcctcgtcaacacgctcctgtccatcgacaccgagtcgtacaagcggcgc
ctcaacctccgccgcttccccgtgatcccgctctcgcccaacaccggcatgcttggctgg
gtcgccaacagtgataccctgcacatcctgatcaaagaataccgcgagcagcacaagatc
ctgctgaacatcgagcaccgcctcatgctccagatggcccctgactacgacaacctcacc
gtactgcaaaaagtcgaggtgttcgagtatgcgctcgacaacacgcctggccaggacctg
taccgcgtgctatggctcaaatcccgctcatccgaggcctggctcgagcgccgcaccgct
tacatgcgcacattggcaacgtcgtctgtcgctggctacatcctcggtcttggcgatcga
cacccatcgaacctgctcctcgaccgtcagaccggcgagatcatccacatcgactttggc
gactgcttcgaaatcgcatgtcaccgccccaagttcccagagaaggtgccgttccgtctc
acacgcatgctcatcaaggccatggaggtcggcggcatccaaggcaccttcaaagtcacc
gcagaaaacaccatgcgtgtcctgcgcgacaatcgcgagagtgtgctcgccttgctcgag
gcatttgtccacgatcccttgatctcctggcgtctcgtgaccgactcggatgccgaacag
cgagcgcccgatgcgcacgaacacgagcatgaggtcgccggcgaaattcgcggcgtcgaa
ggcgaggctcgtaatcagcgtgctcttgaagtcgtccgtcgcattcagaacaaactcacg
ggtcgcgactttcatcccaacatatctttgtcggtgcccgagcagatcgagcgactgatc
caggatgccacgtccatcgagaacttgtgtgtggccttcattggctggtgcgcattctgg
taa

DBGET integrated database retrieval system