KEGG   Malassezia globosa: MGL_3107Help
Entry
MGL_3107          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGL_3107
Translation factors [BR:mgl03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MGL_3107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MPSLNDIRARLNQRGVDITSSAWSPKKQKNTSSVGSETSLSPTKEKGISKMETLGRAEVE
GHMSTQPLEQSKPSKPLQPLHSSETSTSSSASSEPDPTVQRGSGVVADSFARVSVTRTGR
EAAMEAKHGVKHPLENEWTLYYDLQKLHGSASSDQYEATLKRVGHFTTLESFFDTFATLH
RPSRLEKNSNYHFFKNGVKPLWEDPENASGGRWVITLRDRGQTAGSRAGHEALLDRSWMW
LVLALIGETLEENDLVTGAVCSLRGKGDRITVWTRRKEPVDEINSLGQRLLELLELQDEP
GIQMDFSVNSGSKESQQQSYMRKHLTSHAPSAQKQFLQEPQSRESTLGTWLDTNATLHPA
DHVRYYAHQLHSNDQPK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtcttaatgacattcgtgctcgcttgaatcagcgtggcgttgatatcacctcc
tctgcttggagccctaaaaaacaaaaaaacacttcttctgtcggaagcgaaacaagttta
tccccgacgaaagagaaaggaatatcaaaaatggaaacacttggtcgtgccgaagttgaa
ggtcacatgtcaacgcagcccttggagcagtcgaagccatctaaacctttgcaaccattg
cattcatctgagacatcaacatcttcatcggcctcttctgaaccggacccgacggtccag
cgagggtcaggcgttgttgcggactctttcgcgcgtgtctctgtgacaaggactggccgc
gaagctgcgatggaggcaaagcatggggtcaagcatccgcttgaaaatgaatggacattg
tactacgacttgcaaaaacttcatggctcggcaagcagcgatcaatatgaagcaacactc
aagcgcgtaggccacttcacaacgcttgagtccttctttgacacatttgcaacgctgcat
cgtccgagtcgactggagaaaaactccaactatcatttcttcaagaatggcgtcaaaccc
ctgtgggaggatccagagaatgcatctggggggcgctgggttattacgctacgtgatcgt
ggacagactgcgggcagtcgtgctggtcatgaggcgttactggaccgcagttggatgtgg
cttgttctggctcttatcggtgagactctcgaagagaacgatctcgtcactggcgctgtg
tgctcattgagaggcaaaggtgatcgcatcactgtttggacgcgtaggaaagagccagtg
gacgaaattaattctctgggccagcgcctcctcgaattgctcgagctccaagatgagccc
ggtatccagatggacttcagcgtgaattctgggtccaaagaaagtcaacaacagtcttac
atgcgaaaacatctcacaagtcatgcgccatctgcacaaaaacaatttctgcaagaaccc
cagtctcgtgaatcgacgctggggacctggctcgataccaatgcgacacttcatcccgct
gatcatgtgcgatactacgcccatcagctacattctaacgatcaaccaaagtag

DBGET integrated database retrieval system