KEGG   Malassezia globosa: MGL_3129Help
Entry
MGL_3129          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mgl  Malassezia globosa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MGL_3129
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MGL_3129
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MGL_3129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
MSQQMSSMDLNSSQPRQLDVSARNLRMVADLGAGNGGTVSKVEHLPTGVMMAKKVVYIDA
KPDIRKQILRELQILHECHSEFIVGFYGASLSDIHLYMCMEYMDMGSLDSIYQKHGPIEV
DVCGKIVYAVVHGLSYLYEQFRIIHRDVKPSNILVNHQGQIKLCDFGVSGELINSMAHTF
VGTSTYMSPERIQGDQYTIKSDVWSLGITIIEIAHGCFPFAIEMDDDPDATTRAGERRFE
DVRSLSIFELLQHIVHEPPPKLNPEAHFPPSMVDFVKACLLKDPVRRPTPMELRTYPFMV
MASVSNVSLVDWVQRLNAGTPHH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacaaatgagcagcatggacctcaattcatcacagcctcggcaactcgacgtc
agtgcccggaaccttcgcatggtcgctgacctcggtgcaggaaatggcgggaccgtcagc
aaggtggaacacctccccacaggagtcatgatggccaagaaagtcgtgtatattgatgcc
aagcccgacattcgaaagcagattcttcgtgagcttcagatcctgcacgagtgccattct
gaattcatcgttgggttctatggtgcctcgctgagtgatatccatctttacatgtgcatg
gagtacatggacatgggttcgctcgattccatctaccagaaacacggtccaattgaagtg
gatgtgtgcggcaaaattgtctatgctgttgtacatggtctttcatatttgtacgagcaa
ttccgcatcattcatcgcgacgtcaaaccaagcaacattcttgtaaatcaccagggccaa
atcaaactatgtgactttggtgtatcgggtgaactcatcaacagcatggcccacacgttt
gtcggcacgagtacatacatgagtcctgagcggatccaaggcgatcagtacactatcaag
tcagacgtgtggtcactaggtatcactataattgaaatcgctcacgggtgcttccccttc
gcgattgagatggatgatgaccctgacgcaacgactcgcgccggcgaacgccggttcgag
gatgtgcgctccctgtcaatttttgagctgcttcagcacattgtacatgagccaccgccc
aagctcaatcccgaggcacactttcctcctagcatggtcgattttgtgaaagcatgccta
ctcaaagatcccgtgaggcgcccgacaccgatggagcttcgcacctatcccttcatggtt
atggccagcgtctcgaatgtcagtctcgttgactgggttcaacgtctgaatgctggaacg
cctcatcactga

DBGET integrated database retrieval system